Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UHI6

Protein Details
Accession A0A397UHI6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
77-96KLEKPVDVKESKRKKRRKTGBasic
NLS Segment(s)
PositionSequence
80-96KPVDVKESKRKKRRKTG
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039715  ZCCHC10  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF13917  zf-CCHC_3  
Amino Acid Sequences MNKANFPGRRYPTSGTKASPKTQCQKCLEYGHWTYECKNERVYKARPTRTQQLTKPLKPVSVELPNELGIKKEVPEKLEKPVDVKESKRKKRRKTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.51
3 0.53
4 0.53
5 0.56
6 0.58
7 0.56
8 0.6
9 0.63
10 0.68
11 0.64
12 0.63
13 0.62
14 0.6
15 0.55
16 0.52
17 0.47
18 0.44
19 0.41
20 0.37
21 0.33
22 0.35
23 0.36
24 0.3
25 0.32
26 0.31
27 0.34
28 0.39
29 0.42
30 0.44
31 0.5
32 0.56
33 0.57
34 0.58
35 0.62
36 0.63
37 0.66
38 0.59
39 0.61
40 0.62
41 0.58
42 0.59
43 0.5
44 0.45
45 0.39
46 0.38
47 0.33
48 0.32
49 0.31
50 0.26
51 0.26
52 0.26
53 0.26
54 0.24
55 0.19
56 0.13
57 0.13
58 0.13
59 0.17
60 0.18
61 0.2
62 0.28
63 0.29
64 0.36
65 0.41
66 0.4
67 0.38
68 0.41
69 0.45
70 0.43
71 0.48
72 0.51
73 0.56
74 0.66
75 0.74
76 0.79