Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UI10

Protein Details
Accession A0A397UI10    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
27-49KELTHRKTTKLPTKKQLRKTTEGHydrophilic
NLS Segment(s)
PositionSequence
25-27RNK
31-36HRKTTK
109-117RQRKLPTRK
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MKTVPNGPKTTLRRTTKELARRIQRNKELTHRKTTKLPTKKQLRKTTEGLERTNEETKNLTTGKRQNYPPKNNKNHEGLTEPTDEEKKNLTPKNDKITPKNEEEPLTKRQRKLPTRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.68
4 0.71
5 0.7
6 0.69
7 0.72
8 0.76
9 0.78
10 0.79
11 0.79
12 0.76
13 0.73
14 0.74
15 0.75
16 0.71
17 0.73
18 0.68
19 0.63
20 0.64
21 0.68
22 0.68
23 0.67
24 0.7
25 0.69
26 0.76
27 0.81
28 0.83
29 0.84
30 0.8
31 0.76
32 0.73
33 0.7
34 0.67
35 0.63
36 0.54
37 0.46
38 0.41
39 0.39
40 0.39
41 0.31
42 0.23
43 0.21
44 0.19
45 0.2
46 0.19
47 0.16
48 0.18
49 0.24
50 0.29
51 0.33
52 0.39
53 0.46
54 0.55
55 0.65
56 0.7
57 0.74
58 0.78
59 0.77
60 0.77
61 0.73
62 0.65
63 0.56
64 0.5
65 0.41
66 0.35
67 0.32
68 0.27
69 0.23
70 0.24
71 0.22
72 0.2
73 0.21
74 0.22
75 0.28
76 0.32
77 0.37
78 0.43
79 0.5
80 0.58
81 0.63
82 0.65
83 0.64
84 0.67
85 0.66
86 0.64
87 0.63
88 0.58
89 0.55
90 0.54
91 0.51
92 0.53
93 0.58
94 0.57
95 0.56
96 0.6
97 0.66