Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UG67

Protein Details
Accession A0A397UG67    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-24GYINKVRKVRKIGKARELREBasic
NLS Segment(s)
PositionSequence
11-20RKVRKIGKAR
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences ANEMGYINKVRKVRKIGKARELREIGNINKAHKFNETGEVNKSNESGEVNKTNESGKINEPNGSNKDEDVNKAQMGKEYEIREIGNINKAREINETGEVNKSNESGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.72
4 0.78
5 0.83
6 0.78
7 0.77
8 0.71
9 0.61
10 0.57
11 0.53
12 0.44
13 0.43
14 0.41
15 0.34
16 0.37
17 0.37
18 0.32
19 0.29
20 0.3
21 0.24
22 0.31
23 0.3
24 0.26
25 0.3
26 0.32
27 0.3
28 0.27
29 0.26
30 0.17
31 0.16
32 0.15
33 0.13
34 0.13
35 0.17
36 0.17
37 0.17
38 0.18
39 0.18
40 0.18
41 0.18
42 0.16
43 0.15
44 0.2
45 0.21
46 0.23
47 0.24
48 0.27
49 0.28
50 0.28
51 0.25
52 0.19
53 0.23
54 0.21
55 0.22
56 0.22
57 0.21
58 0.2
59 0.21
60 0.21
61 0.21
62 0.23
63 0.23
64 0.24
65 0.24
66 0.24
67 0.24
68 0.24
69 0.21
70 0.2
71 0.2
72 0.23
73 0.24
74 0.24
75 0.27
76 0.28
77 0.29
78 0.31
79 0.32
80 0.27
81 0.29
82 0.3
83 0.27
84 0.31
85 0.31
86 0.29
87 0.25