Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UAR1

Protein Details
Accession A0A397UAR1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
34-61KAKVLNKSIKNKKKTTKTKKKLKVIVIDHydrophilic
NLS Segment(s)
PositionSequence
34-56KAKVLNKSIKNKKKTTKTKKKLK
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MKNLKLIERKLDNEKFAAIRIHRQYNITSHRHDKAKVLNKSIKNKKKTTKTKKKLKVIVIDSEDSSRNNHKESLNLKYQEQLLVAYFREYTVALRECEAKVHLVELANLEKEQALKPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.4
3 0.36
4 0.37
5 0.29
6 0.33
7 0.37
8 0.41
9 0.4
10 0.41
11 0.41
12 0.43
13 0.49
14 0.45
15 0.44
16 0.43
17 0.48
18 0.5
19 0.49
20 0.45
21 0.47
22 0.53
23 0.53
24 0.54
25 0.56
26 0.59
27 0.69
28 0.74
29 0.73
30 0.71
31 0.74
32 0.75
33 0.78
34 0.82
35 0.83
36 0.84
37 0.85
38 0.89
39 0.9
40 0.91
41 0.88
42 0.83
43 0.8
44 0.72
45 0.67
46 0.59
47 0.5
48 0.41
49 0.35
50 0.29
51 0.21
52 0.19
53 0.18
54 0.16
55 0.17
56 0.2
57 0.19
58 0.24
59 0.27
60 0.31
61 0.34
62 0.34
63 0.33
64 0.32
65 0.33
66 0.27
67 0.24
68 0.19
69 0.13
70 0.12
71 0.12
72 0.11
73 0.1
74 0.09
75 0.09
76 0.09
77 0.09
78 0.13
79 0.16
80 0.15
81 0.17
82 0.2
83 0.19
84 0.21
85 0.21
86 0.17
87 0.15
88 0.15
89 0.16
90 0.14
91 0.15
92 0.16
93 0.18
94 0.17
95 0.17
96 0.16
97 0.15
98 0.16
99 0.17