Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VNY4

Protein Details
Accession A0A397VNY4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-34QSFIILREMKNKKKQNKQNETSESKKHydrophilic
NLS Segment(s)
PositionSequence
75-78RRRK
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
Amino Acid Sequences MSWTLGSLQSFIILREMKNKKKQNKQNETSESKKVNKKYNVSQQELLKMLYGRWRARHREFNIRKQGDEQVERNRRRKAKNSMLLNLLHNRINPVVELLHKKQPALKRLRITSQKYIQQTCFPPFGAPTWCLTNEALKKLNFPIENIPIYDSEKAMKILTLPKINKDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.27
3 0.36
4 0.42
5 0.52
6 0.62
7 0.66
8 0.75
9 0.85
10 0.86
11 0.88
12 0.86
13 0.87
14 0.86
15 0.84
16 0.79
17 0.77
18 0.72
19 0.69
20 0.69
21 0.65
22 0.66
23 0.66
24 0.68
25 0.69
26 0.73
27 0.73
28 0.72
29 0.7
30 0.63
31 0.59
32 0.53
33 0.44
34 0.35
35 0.27
36 0.22
37 0.23
38 0.27
39 0.25
40 0.31
41 0.38
42 0.44
43 0.5
44 0.59
45 0.58
46 0.63
47 0.68
48 0.7
49 0.74
50 0.68
51 0.61
52 0.54
53 0.55
54 0.49
55 0.46
56 0.4
57 0.4
58 0.48
59 0.53
60 0.56
61 0.58
62 0.6
63 0.62
64 0.67
65 0.67
66 0.68
67 0.69
68 0.69
69 0.64
70 0.6
71 0.55
72 0.48
73 0.41
74 0.32
75 0.25
76 0.19
77 0.17
78 0.15
79 0.13
80 0.11
81 0.09
82 0.08
83 0.1
84 0.16
85 0.17
86 0.24
87 0.24
88 0.24
89 0.28
90 0.33
91 0.39
92 0.42
93 0.46
94 0.46
95 0.49
96 0.58
97 0.62
98 0.62
99 0.62
100 0.61
101 0.61
102 0.59
103 0.6
104 0.53
105 0.5
106 0.48
107 0.43
108 0.38
109 0.32
110 0.28
111 0.25
112 0.25
113 0.23
114 0.2
115 0.19
116 0.2
117 0.2
118 0.22
119 0.21
120 0.27
121 0.27
122 0.31
123 0.33
124 0.3
125 0.32
126 0.33
127 0.39
128 0.32
129 0.3
130 0.32
131 0.33
132 0.34
133 0.33
134 0.31
135 0.26
136 0.28
137 0.27
138 0.21
139 0.17
140 0.18
141 0.18
142 0.17
143 0.16
144 0.16
145 0.22
146 0.28
147 0.36
148 0.36