Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UE51

Protein Details
Accession A0A397UE51    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
50-71TAMLNRKKRRKVSVRLKRDHEABasic
NLS Segment(s)
PositionSequence
55-65RKKRRKVSVRL
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MVIVKTRGEIRKERSQAKSNSTCRCTLGKLRIVNCKIVRQNQAYVQASNTAMLNRKKRRKVSVRLKRDHEAEIANIPLRVLEMNKEFNMAAKEYTTWPLPLTHFIRSHILIIKQNWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.69
3 0.7
4 0.72
5 0.74
6 0.72
7 0.73
8 0.68
9 0.62
10 0.56
11 0.53
12 0.48
13 0.46
14 0.46
15 0.44
16 0.46
17 0.49
18 0.55
19 0.54
20 0.57
21 0.51
22 0.51
23 0.5
24 0.5
25 0.52
26 0.46
27 0.47
28 0.44
29 0.5
30 0.44
31 0.38
32 0.32
33 0.28
34 0.25
35 0.22
36 0.18
37 0.11
38 0.15
39 0.2
40 0.28
41 0.35
42 0.44
43 0.51
44 0.56
45 0.65
46 0.69
47 0.74
48 0.77
49 0.78
50 0.8
51 0.8
52 0.8
53 0.74
54 0.67
55 0.58
56 0.49
57 0.4
58 0.3
59 0.24
60 0.2
61 0.16
62 0.14
63 0.11
64 0.09
65 0.08
66 0.08
67 0.07
68 0.09
69 0.12
70 0.15
71 0.16
72 0.17
73 0.17
74 0.18
75 0.2
76 0.18
77 0.15
78 0.13
79 0.14
80 0.15
81 0.18
82 0.17
83 0.15
84 0.15
85 0.17
86 0.18
87 0.25
88 0.26
89 0.3
90 0.3
91 0.32
92 0.36
93 0.35
94 0.36
95 0.34
96 0.36
97 0.36