Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UQ21

Protein Details
Accession A0A397UQ21    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-34THTLCRRCGRRAFHNQKKTCHydrophilic
62-81GRMRYLKHVSRRFKNGFREGBasic
NLS Segment(s)
PositionSequence
52-65KGKRRKTTGTGRMR
Subcellular Location(s) mito_nucl 10.333, nucl 10, mito 9.5, cyto_nucl 9.333, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTSSFGKRHTKTHTLCRRCGRRAFHNQKKTCAQCGYPSAKTRSYNWSVKGKRRKTTGTGRMRYLKHVSRRFKNGFREGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.7
4 0.66
5 0.72
6 0.76
7 0.77
8 0.74
9 0.76
10 0.72
11 0.71
12 0.76
13 0.79
14 0.79
15 0.81
16 0.77
17 0.76
18 0.77
19 0.7
20 0.64
21 0.56
22 0.46
23 0.4
24 0.43
25 0.42
26 0.38
27 0.39
28 0.37
29 0.38
30 0.39
31 0.37
32 0.38
33 0.38
34 0.39
35 0.39
36 0.46
37 0.48
38 0.56
39 0.64
40 0.64
41 0.65
42 0.67
43 0.67
44 0.65
45 0.7
46 0.7
47 0.71
48 0.68
49 0.68
50 0.69
51 0.65
52 0.64
53 0.61
54 0.59
55 0.59
56 0.63
57 0.67
58 0.68
59 0.76
60 0.78
61 0.79
62 0.8