Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LK08

Protein Details
Accession E2LK08   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
143-175DESKVERRIHKKYPYPRLWRKPRRNIIESQDTAHydrophilic
NLS Segment(s)
PositionSequence
154-166KKYPYPRLWRKPR
Subcellular Location(s) nucl 14, cyto 7, cyto_mito 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006329  AMPD  
IPR032466  Metal_Hydrolase  
Gene Ontology GO:0003876  F:AMP deaminase activity  
GO:0032264  P:IMP salvage  
KEGG mpr:MPER_06973  -  
Pfam View protein in Pfam  
PF19326  AMP_deaminase  
Amino Acid Sequences IAQLAFGVTRNGGKVDTHVHHSSSMNHXLFFGGKIEKKRSPHARVITLLARFLPSCRLSDVVSDASGESRLRGIFIKTDKEIVRDWYLAELTKEVMTDLEHKSPEEWDKLAIWVVNNKLYWHNDNGSVNTFEDVVIIGFDTVDDESKVERRIHKKYPYPRLWRKPRRNIIESQDTAFSSKSGLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.21
3 0.23
4 0.29
5 0.3
6 0.3
7 0.32
8 0.33
9 0.33
10 0.33
11 0.37
12 0.3
13 0.28
14 0.27
15 0.25
16 0.23
17 0.26
18 0.24
19 0.23
20 0.27
21 0.34
22 0.39
23 0.42
24 0.52
25 0.57
26 0.57
27 0.62
28 0.64
29 0.62
30 0.59
31 0.6
32 0.55
33 0.45
34 0.39
35 0.3
36 0.24
37 0.19
38 0.18
39 0.19
40 0.15
41 0.15
42 0.16
43 0.17
44 0.16
45 0.18
46 0.2
47 0.15
48 0.14
49 0.13
50 0.12
51 0.11
52 0.12
53 0.1
54 0.07
55 0.07
56 0.07
57 0.08
58 0.09
59 0.09
60 0.12
61 0.15
62 0.18
63 0.17
64 0.22
65 0.22
66 0.23
67 0.23
68 0.23
69 0.22
70 0.19
71 0.19
72 0.15
73 0.15
74 0.13
75 0.13
76 0.09
77 0.07
78 0.07
79 0.07
80 0.06
81 0.05
82 0.06
83 0.09
84 0.11
85 0.12
86 0.13
87 0.13
88 0.13
89 0.15
90 0.17
91 0.16
92 0.14
93 0.13
94 0.13
95 0.13
96 0.14
97 0.12
98 0.1
99 0.12
100 0.13
101 0.15
102 0.14
103 0.15
104 0.18
105 0.21
106 0.23
107 0.23
108 0.23
109 0.24
110 0.26
111 0.26
112 0.26
113 0.24
114 0.21
115 0.18
116 0.17
117 0.12
118 0.11
119 0.09
120 0.06
121 0.05
122 0.04
123 0.04
124 0.03
125 0.03
126 0.04
127 0.04
128 0.05
129 0.05
130 0.06
131 0.08
132 0.11
133 0.16
134 0.19
135 0.27
136 0.34
137 0.42
138 0.5
139 0.58
140 0.65
141 0.71
142 0.78
143 0.8
144 0.84
145 0.87
146 0.89
147 0.91
148 0.93
149 0.93
150 0.94
151 0.94
152 0.93
153 0.87
154 0.84
155 0.82
156 0.81
157 0.72
158 0.64
159 0.56
160 0.47
161 0.43
162 0.36
163 0.27