Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U0J1

Protein Details
Accession A0A397U0J1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
118-145SIDTSNKQVKKRKYRSKSIRISNSPNSGHydrophilic
NLS Segment(s)
PositionSequence
127-151KKRKYRSKSIRISNSPNSGASAKKK
Subcellular Location(s) nucl 19, mito_nucl 12.499, cyto_nucl 12.333, mito 4.5
Family & Domain DBs
Amino Acid Sequences MAKRMRSDAVPLSPEDYKFIMQYHDAKPKTDILKKLREKYPMTNNRFYKIWRGQEVSMIEWYQPISESITLPSQDLPIPELLPESCLPSIGYTSSTEGTSSITENSNKSNKDILHLTSIDTSNKQVKKRKYRSKSIRISNSPNSGASAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.26
4 0.21
5 0.2
6 0.2
7 0.18
8 0.19
9 0.25
10 0.29
11 0.37
12 0.36
13 0.37
14 0.38
15 0.43
16 0.47
17 0.47
18 0.48
19 0.46
20 0.56
21 0.63
22 0.69
23 0.67
24 0.67
25 0.65
26 0.65
27 0.69
28 0.69
29 0.68
30 0.69
31 0.65
32 0.61
33 0.58
34 0.51
35 0.49
36 0.47
37 0.46
38 0.41
39 0.43
40 0.4
41 0.44
42 0.43
43 0.35
44 0.29
45 0.23
46 0.18
47 0.15
48 0.14
49 0.09
50 0.08
51 0.07
52 0.07
53 0.07
54 0.07
55 0.08
56 0.1
57 0.1
58 0.1
59 0.1
60 0.09
61 0.09
62 0.09
63 0.09
64 0.08
65 0.07
66 0.07
67 0.07
68 0.06
69 0.08
70 0.08
71 0.09
72 0.08
73 0.09
74 0.09
75 0.09
76 0.09
77 0.08
78 0.09
79 0.08
80 0.09
81 0.1
82 0.1
83 0.1
84 0.09
85 0.1
86 0.09
87 0.09
88 0.09
89 0.11
90 0.13
91 0.14
92 0.19
93 0.23
94 0.23
95 0.25
96 0.28
97 0.26
98 0.29
99 0.31
100 0.27
101 0.27
102 0.27
103 0.26
104 0.24
105 0.26
106 0.23
107 0.22
108 0.23
109 0.27
110 0.31
111 0.38
112 0.43
113 0.52
114 0.61
115 0.71
116 0.79
117 0.8
118 0.86
119 0.9
120 0.92
121 0.92
122 0.91
123 0.91
124 0.88
125 0.87
126 0.84
127 0.8
128 0.71
129 0.61
130 0.54
131 0.46