Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397URX8

Protein Details
Accession A0A397URX8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
57-76EEINTKKKTRKPLGRILLKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 4.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
IPR027078  snRNP-E  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005681  C:spliceosomal complex  
GO:0005685  C:U1 snRNP  
GO:0005686  C:U2 snRNP  
GO:0005687  C:U4 snRNP  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0005682  C:U5 snRNP  
GO:0003723  F:RNA binding  
GO:0000387  P:spliceosomal snRNP assembly  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01718  Sm_E  
Amino Acid Sequences MATKVQKIMVQPINLIFKYLQNKTRVQIWLYEQVDLRIEGQIIGFDEFMNLVLDHAEEINTKKKTRKPLGRILLKGDNITLIQSVGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.26
4 0.26
5 0.31
6 0.35
7 0.36
8 0.34
9 0.37
10 0.37
11 0.43
12 0.4
13 0.35
14 0.34
15 0.32
16 0.37
17 0.35
18 0.35
19 0.28
20 0.26
21 0.26
22 0.22
23 0.18
24 0.09
25 0.09
26 0.07
27 0.07
28 0.06
29 0.06
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.08
46 0.15
47 0.18
48 0.21
49 0.28
50 0.33
51 0.44
52 0.54
53 0.62
54 0.62
55 0.7
56 0.78
57 0.81
58 0.78
59 0.75
60 0.71
61 0.62
62 0.55
63 0.45
64 0.36
65 0.27
66 0.25
67 0.18