Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VMS6

Protein Details
Accession A0A397VMS6    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-77LDMFRSLDKPTKKKKNLKKRFFAATIHydrophilic
NLS Segment(s)
PositionSequence
61-71PTKKKKNLKKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MSVGEKKNRLQTALKSFARNRNIKKVGHEEVRDYYDYKSAKCLDSNNNIVILDMFRSLDKPTKKKKNLKKRFFAATI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.55
3 0.58
4 0.63
5 0.66
6 0.66
7 0.62
8 0.63
9 0.65
10 0.61
11 0.61
12 0.6
13 0.58
14 0.56
15 0.52
16 0.44
17 0.42
18 0.43
19 0.37
20 0.3
21 0.24
22 0.23
23 0.22
24 0.19
25 0.2
26 0.18
27 0.19
28 0.19
29 0.22
30 0.23
31 0.28
32 0.31
33 0.28
34 0.27
35 0.26
36 0.24
37 0.21
38 0.15
39 0.1
40 0.08
41 0.07
42 0.07
43 0.08
44 0.1
45 0.17
46 0.25
47 0.33
48 0.44
49 0.54
50 0.65
51 0.74
52 0.83
53 0.88
54 0.91
55 0.92
56 0.92
57 0.89