Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U6P4

Protein Details
Accession A0A397U6P4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
52-90TPRTTTPRKEATKKKKKVQKSITRMKKNKIIKKNLDLPVHydrophilic
NLS Segment(s)
PositionSequence
58-84PRKEATKKKKKVQKSITRMKKNKIIKK
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MTPRMMTPRMTTPKTMTPRMTTPRTITPKKMTPRPTTLRTTTPRTTTPRTMTPRTTTPRKEATKKKKKVQKSITRMKKNKIIKKNLDLPVVDQSKSRSTPSTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.51
4 0.47
5 0.53
6 0.57
7 0.57
8 0.51
9 0.49
10 0.53
11 0.58
12 0.57
13 0.55
14 0.55
15 0.58
16 0.62
17 0.66
18 0.64
19 0.62
20 0.67
21 0.67
22 0.65
23 0.63
24 0.59
25 0.59
26 0.56
27 0.56
28 0.51
29 0.47
30 0.47
31 0.47
32 0.48
33 0.46
34 0.45
35 0.46
36 0.48
37 0.49
38 0.46
39 0.44
40 0.46
41 0.47
42 0.5
43 0.45
44 0.44
45 0.5
46 0.53
47 0.59
48 0.62
49 0.67
50 0.71
51 0.77
52 0.81
53 0.81
54 0.84
55 0.86
56 0.86
57 0.85
58 0.85
59 0.87
60 0.88
61 0.91
62 0.88
63 0.83
64 0.82
65 0.81
66 0.8
67 0.8
68 0.79
69 0.77
70 0.79
71 0.82
72 0.79
73 0.74
74 0.65
75 0.57
76 0.56
77 0.5
78 0.42
79 0.34
80 0.31
81 0.33
82 0.35
83 0.35