Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TVS8

Protein Details
Accession A0A397TVS8    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTTKGTTKSTTKRRPKAPPNDNITKKIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MTTKGTTKSTTKRRPKAPPNDNITKKIPYNNGDEKHQQTTTKSTTKLHISKQPKAPPNDDQKYHQRHYQTMTKGTTKRRTTKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.9
4 0.88
5 0.87
6 0.84
7 0.86
8 0.81
9 0.75
10 0.68
11 0.62
12 0.54
13 0.5
14 0.47
15 0.4
16 0.43
17 0.46
18 0.44
19 0.44
20 0.47
21 0.44
22 0.43
23 0.41
24 0.35
25 0.28
26 0.31
27 0.32
28 0.31
29 0.29
30 0.26
31 0.29
32 0.35
33 0.38
34 0.36
35 0.41
36 0.43
37 0.49
38 0.56
39 0.61
40 0.6
41 0.61
42 0.61
43 0.6
44 0.64
45 0.64
46 0.58
47 0.56
48 0.59
49 0.62
50 0.61
51 0.58
52 0.51
53 0.48
54 0.51
55 0.54
56 0.5
57 0.49
58 0.51
59 0.55
60 0.57
61 0.63
62 0.67
63 0.67