Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397V9C7

Protein Details
Accession A0A397V9C7    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
51-77DSKNKTKESVKKRPYKHKQPSFTRDYFHydrophilic
NLS Segment(s)
PositionSequence
61-64KKRP
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MNNYEMIDDNKYYPNNYYYEIAKDSRTSTETFSSAATTPSVQTTYFSKLSDSKNKTKESVKKRPYKHKQPSFTRDYFDKKVNEKGKEVRVCKIINEGGQKCGTEFKSIGSLTGNLITHLRDNHGIVSQDGEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.27
4 0.27
5 0.24
6 0.26
7 0.29
8 0.27
9 0.26
10 0.25
11 0.24
12 0.25
13 0.25
14 0.22
15 0.22
16 0.23
17 0.22
18 0.21
19 0.19
20 0.18
21 0.16
22 0.16
23 0.13
24 0.11
25 0.11
26 0.11
27 0.12
28 0.1
29 0.11
30 0.12
31 0.17
32 0.18
33 0.17
34 0.18
35 0.22
36 0.28
37 0.36
38 0.4
39 0.43
40 0.48
41 0.5
42 0.52
43 0.55
44 0.58
45 0.59
46 0.63
47 0.64
48 0.66
49 0.72
50 0.8
51 0.82
52 0.84
53 0.85
54 0.83
55 0.84
56 0.84
57 0.84
58 0.81
59 0.72
60 0.64
61 0.57
62 0.55
63 0.48
64 0.45
65 0.42
66 0.37
67 0.44
68 0.48
69 0.47
70 0.45
71 0.48
72 0.51
73 0.54
74 0.54
75 0.49
76 0.47
77 0.45
78 0.41
79 0.4
80 0.34
81 0.3
82 0.37
83 0.34
84 0.32
85 0.32
86 0.32
87 0.26
88 0.3
89 0.27
90 0.22
91 0.21
92 0.19
93 0.24
94 0.24
95 0.24
96 0.2
97 0.19
98 0.17
99 0.21
100 0.19
101 0.14
102 0.15
103 0.16
104 0.17
105 0.17
106 0.2
107 0.18
108 0.19
109 0.2
110 0.24
111 0.24
112 0.21