Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397V1L0

Protein Details
Accession A0A397V1L0    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
45-77LACKNKYRRRYYIHNQRKRLNPFKQTNRNLNSHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, mito_nucl 13.666, nucl 11, cyto_nucl 7.666
Family & Domain DBs
Amino Acid Sequences MFRKQFSKAVSYVRMFELNHVNGIDSFVKSYVNRNIRYNIHPYFLACKNKYRRRYYIHNQRKRLNPFKQTNRNLNSHPKGSLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.33
4 0.34
5 0.28
6 0.27
7 0.25
8 0.23
9 0.19
10 0.22
11 0.19
12 0.12
13 0.12
14 0.1
15 0.12
16 0.12
17 0.16
18 0.22
19 0.27
20 0.29
21 0.31
22 0.36
23 0.38
24 0.4
25 0.42
26 0.35
27 0.3
28 0.27
29 0.25
30 0.26
31 0.29
32 0.34
33 0.29
34 0.36
35 0.44
36 0.53
37 0.61
38 0.64
39 0.65
40 0.64
41 0.73
42 0.76
43 0.77
44 0.8
45 0.8
46 0.8
47 0.8
48 0.83
49 0.83
50 0.82
51 0.79
52 0.78
53 0.79
54 0.83
55 0.86
56 0.85
57 0.85
58 0.81
59 0.78
60 0.74
61 0.74
62 0.71
63 0.63