Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VZV7

Protein Details
Accession A0A397VZV7    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-54KYTWKAYCTKQKQMRKDQHAQKKIHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 2, pero 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007854  Fip1_dom  
IPR044976  FIPS3/FIPS5-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
Pfam View protein in Pfam  
PF05182  Fip1  
Amino Acid Sequences YDVDLDSVEDKPWRKPGADITDYFNYGFNKYTWKAYCTKQKQMRKDQHAQKKIHVRHIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.37
4 0.41
5 0.43
6 0.41
7 0.4
8 0.4
9 0.39
10 0.37
11 0.31
12 0.22
13 0.19
14 0.19
15 0.13
16 0.16
17 0.16
18 0.21
19 0.2
20 0.22
21 0.25
22 0.3
23 0.41
24 0.43
25 0.52
26 0.56
27 0.64
28 0.71
29 0.78
30 0.83
31 0.81
32 0.85
33 0.85
34 0.86
35 0.86
36 0.8
37 0.78
38 0.78
39 0.76