Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397W8Y6

Protein Details
Accession A0A397W8Y6    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
80-118PLDLRPKKTRAIRRKLTKDEASRKTRRAHIRSIHFPQRKBasic
NLS Segment(s)
PositionSequence
74-118KGRKYIPLDLRPKKTRAIRRKLTKDEASRKTRRAHIRSIHFPQRK
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAPVKTYELRQKNKEGLLKQLDELKQELASLKVQKIAGGTAAKLTKLREVRKSIARVNTVISQTQREHTRKFYKGRKYIPLDLRPKKTRAIRRKLTKDEASRKTRRAHIRSIHFPQRKFAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.6
3 0.59
4 0.58
5 0.54
6 0.48
7 0.49
8 0.43
9 0.38
10 0.37
11 0.29
12 0.22
13 0.21
14 0.2
15 0.14
16 0.17
17 0.18
18 0.18
19 0.2
20 0.2
21 0.2
22 0.2
23 0.18
24 0.17
25 0.15
26 0.14
27 0.14
28 0.15
29 0.14
30 0.15
31 0.16
32 0.18
33 0.24
34 0.29
35 0.32
36 0.37
37 0.41
38 0.47
39 0.5
40 0.49
41 0.48
42 0.45
43 0.39
44 0.36
45 0.35
46 0.29
47 0.26
48 0.22
49 0.19
50 0.18
51 0.21
52 0.26
53 0.26
54 0.27
55 0.33
56 0.4
57 0.43
58 0.51
59 0.56
60 0.59
61 0.64
62 0.68
63 0.7
64 0.69
65 0.72
66 0.72
67 0.72
68 0.73
69 0.72
70 0.75
71 0.7
72 0.66
73 0.64
74 0.64
75 0.66
76 0.66
77 0.69
78 0.71
79 0.77
80 0.84
81 0.86
82 0.85
83 0.84
84 0.83
85 0.83
86 0.82
87 0.81
88 0.78
89 0.75
90 0.73
91 0.74
92 0.74
93 0.7
94 0.7
95 0.7
96 0.72
97 0.76
98 0.79
99 0.8
100 0.77
101 0.72
102 0.68
103 0.67