Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VPF2

Protein Details
Accession A0A397VPF2    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
19-45YTEKTSCLFCRKNRRKCEKSDENSNQCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MGSFLKSMQNKYYKQEKLYTEKTSCLFCRKNRRKCEKSDENSNQCRDCLERNIECVKYSPLKTEEYITKMTHKLKDHEGRISELELKVLKLENENLKIKSVLNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.57
4 0.57
5 0.62
6 0.62
7 0.54
8 0.53
9 0.5
10 0.48
11 0.44
12 0.44
13 0.44
14 0.44
15 0.53
16 0.6
17 0.68
18 0.74
19 0.82
20 0.8
21 0.82
22 0.85
23 0.84
24 0.8
25 0.82
26 0.8
27 0.78
28 0.78
29 0.72
30 0.62
31 0.51
32 0.46
33 0.36
34 0.29
35 0.26
36 0.25
37 0.22
38 0.25
39 0.29
40 0.28
41 0.27
42 0.25
43 0.23
44 0.22
45 0.21
46 0.22
47 0.21
48 0.23
49 0.23
50 0.25
51 0.25
52 0.24
53 0.27
54 0.24
55 0.25
56 0.28
57 0.32
58 0.35
59 0.35
60 0.35
61 0.42
62 0.49
63 0.5
64 0.51
65 0.48
66 0.45
67 0.43
68 0.42
69 0.36
70 0.28
71 0.27
72 0.21
73 0.2
74 0.18
75 0.18
76 0.17
77 0.16
78 0.22
79 0.27
80 0.32
81 0.37
82 0.37
83 0.38
84 0.38