Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VZF0

Protein Details
Accession A0A397VZF0    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKHIKDKCVNCGKNRNLKPNKLCTCCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 11.833, nucl 8, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR017441  Protein_kinase_ATP_BS  
Gene Ontology GO:0005524  F:ATP binding  
PROSITE View protein in PROSITE  
PS00107  PROTEIN_KINASE_ATP  
Amino Acid Sequences MKHIKDKCVNCGKNRNLKPNKLCTCCNSKQTKCIGCSRKVKLCYENNKLCTECYHARQILNINSGNQDIDNLIKATHNKQIKYRLEWIPFTDFVDIKQIGSGGFSEVFTATWTKGTLNSFKTRNKNMTVVLKVLKDSSNINSAFLNEVYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.81
4 0.84
5 0.84
6 0.84
7 0.84
8 0.79
9 0.74
10 0.69
11 0.69
12 0.65
13 0.66
14 0.65
15 0.59
16 0.61
17 0.66
18 0.67
19 0.62
20 0.65
21 0.63
22 0.61
23 0.67
24 0.67
25 0.66
26 0.64
27 0.64
28 0.63
29 0.66
30 0.67
31 0.67
32 0.68
33 0.63
34 0.61
35 0.57
36 0.49
37 0.41
38 0.39
39 0.33
40 0.29
41 0.32
42 0.31
43 0.3
44 0.32
45 0.35
46 0.31
47 0.31
48 0.28
49 0.22
50 0.21
51 0.21
52 0.19
53 0.14
54 0.11
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.07
61 0.08
62 0.1
63 0.16
64 0.2
65 0.2
66 0.24
67 0.34
68 0.36
69 0.39
70 0.44
71 0.44
72 0.44
73 0.44
74 0.43
75 0.37
76 0.34
77 0.3
78 0.25
79 0.19
80 0.16
81 0.2
82 0.17
83 0.13
84 0.13
85 0.12
86 0.1
87 0.11
88 0.1
89 0.06
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.08
96 0.09
97 0.08
98 0.08
99 0.09
100 0.09
101 0.12
102 0.15
103 0.2
104 0.24
105 0.3
106 0.35
107 0.43
108 0.51
109 0.55
110 0.58
111 0.57
112 0.56
113 0.56
114 0.58
115 0.53
116 0.5
117 0.46
118 0.41
119 0.37
120 0.36
121 0.31
122 0.24
123 0.24
124 0.23
125 0.26
126 0.25
127 0.25
128 0.23
129 0.23
130 0.25