Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TXK2

Protein Details
Accession A0A397TXK2    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-27IVFNKFYSKRNIKHGKCRNCDRYKHIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 13, nucl 9.5
Family & Domain DBs
Amino Acid Sequences MIVFNKFYSKRNIKHGKCRNCDRYKHIIRLVPNTWSIDKRKYKLNDVLKNMKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.8
3 0.8
4 0.8
5 0.85
6 0.85
7 0.82
8 0.81
9 0.77
10 0.78
11 0.74
12 0.71
13 0.65
14 0.58
15 0.52
16 0.53
17 0.47
18 0.38
19 0.34
20 0.3
21 0.28
22 0.29
23 0.31
24 0.34
25 0.4
26 0.4
27 0.47
28 0.5
29 0.56
30 0.61
31 0.68
32 0.67
33 0.68