Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TV06

Protein Details
Accession A0A397TV06    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
158-180WKENNKHKTKCFCISRRRTSEEAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001471  AP2/ERF_dom  
IPR044925  His-Me_finger_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00847  AP2  
Amino Acid Sequences MDSNWEDKFENFEVLSEWEKSTSTNNNKKLNYFHLVEINSKVYYEVQTQKPEIMFLLDLKHYKLLEDHTWYSWTTKKRNTYYILTGTNKTIKKVHRMIHLKWPIIDHINRNGLDNRECNLRKTTPRENNLNRWKRKDNTSGYNGISFDKNMNAWVFDWKENNKHKTKCFCISRRRTSEEAKKLAVEFKLAHNKITDNRNGYDVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.2
4 0.19
5 0.17
6 0.17
7 0.17
8 0.21
9 0.28
10 0.35
11 0.43
12 0.51
13 0.58
14 0.6
15 0.63
16 0.63
17 0.59
18 0.54
19 0.47
20 0.42
21 0.39
22 0.39
23 0.38
24 0.35
25 0.31
26 0.26
27 0.23
28 0.21
29 0.16
30 0.17
31 0.2
32 0.25
33 0.27
34 0.31
35 0.32
36 0.34
37 0.32
38 0.31
39 0.25
40 0.19
41 0.15
42 0.12
43 0.14
44 0.13
45 0.14
46 0.15
47 0.17
48 0.15
49 0.15
50 0.15
51 0.17
52 0.18
53 0.23
54 0.24
55 0.22
56 0.24
57 0.24
58 0.25
59 0.26
60 0.28
61 0.29
62 0.34
63 0.41
64 0.44
65 0.49
66 0.52
67 0.51
68 0.51
69 0.5
70 0.49
71 0.43
72 0.4
73 0.36
74 0.38
75 0.34
76 0.3
77 0.3
78 0.27
79 0.32
80 0.38
81 0.4
82 0.43
83 0.48
84 0.49
85 0.54
86 0.57
87 0.5
88 0.44
89 0.4
90 0.32
91 0.3
92 0.3
93 0.22
94 0.21
95 0.25
96 0.24
97 0.26
98 0.26
99 0.25
100 0.26
101 0.24
102 0.21
103 0.25
104 0.25
105 0.26
106 0.28
107 0.3
108 0.34
109 0.39
110 0.48
111 0.49
112 0.54
113 0.61
114 0.63
115 0.69
116 0.74
117 0.77
118 0.73
119 0.71
120 0.73
121 0.68
122 0.7
123 0.69
124 0.65
125 0.63
126 0.62
127 0.6
128 0.53
129 0.51
130 0.44
131 0.36
132 0.29
133 0.22
134 0.18
135 0.14
136 0.13
137 0.13
138 0.13
139 0.12
140 0.12
141 0.17
142 0.19
143 0.2
144 0.25
145 0.27
146 0.35
147 0.43
148 0.51
149 0.54
150 0.58
151 0.64
152 0.68
153 0.72
154 0.73
155 0.74
156 0.75
157 0.77
158 0.81
159 0.84
160 0.82
161 0.82
162 0.77
163 0.77
164 0.78
165 0.77
166 0.72
167 0.64
168 0.58
169 0.53
170 0.52
171 0.43
172 0.36
173 0.28
174 0.31
175 0.4
176 0.38
177 0.38
178 0.35
179 0.39
180 0.42
181 0.48
182 0.47
183 0.41
184 0.42