Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VF71

Protein Details
Accession A0A397VF71    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
28-56RINETSRFKNKYKRSKENKTRIENKIYSRHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, cyto 6.5, mito 5, cyto_nucl 5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009003  Peptidase_S1_PA  
IPR043504  Peptidase_S1_PA_chymotrypsin  
Amino Acid Sequences MIAIPSIASVISQRNNLSDTLAFRTSERINETSRFKNKYKRSKENKTRIENKIYSRRNVIKPPFDSVVNPNHNYPIGFFIANNGSVEDVCTASVIHTENGNIGLIAAHCLLDDNGNPWNLSFLSFSPGYDYGTNGPLGAIPVVDIAMPNYYNINRNKFDYALVRFEFNHGGSTLQDYTGALGWRFDIGNGEPTSVYGYPDRGNFENCVHDGEHLCKWQGITEKVTSKYIYVISNFSDGFGASGGPLISQYDTKTNLGYAYAVIRGNLDGYDNTSVGSIWNEIVFLDLLYRITHNIIIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.24
4 0.25
5 0.22
6 0.22
7 0.25
8 0.26
9 0.24
10 0.23
11 0.28
12 0.27
13 0.29
14 0.31
15 0.28
16 0.31
17 0.36
18 0.42
19 0.46
20 0.52
21 0.54
22 0.55
23 0.62
24 0.68
25 0.74
26 0.78
27 0.8
28 0.82
29 0.87
30 0.92
31 0.93
32 0.93
33 0.92
34 0.91
35 0.87
36 0.86
37 0.81
38 0.79
39 0.78
40 0.74
41 0.68
42 0.67
43 0.68
44 0.65
45 0.69
46 0.68
47 0.66
48 0.63
49 0.64
50 0.57
51 0.5
52 0.46
53 0.4
54 0.42
55 0.4
56 0.39
57 0.34
58 0.34
59 0.33
60 0.31
61 0.27
62 0.21
63 0.16
64 0.15
65 0.14
66 0.15
67 0.16
68 0.16
69 0.16
70 0.12
71 0.1
72 0.1
73 0.11
74 0.08
75 0.07
76 0.06
77 0.06
78 0.06
79 0.05
80 0.08
81 0.08
82 0.08
83 0.08
84 0.08
85 0.09
86 0.09
87 0.09
88 0.07
89 0.06
90 0.06
91 0.05
92 0.06
93 0.06
94 0.05
95 0.05
96 0.05
97 0.06
98 0.06
99 0.06
100 0.06
101 0.08
102 0.09
103 0.09
104 0.09
105 0.1
106 0.09
107 0.1
108 0.1
109 0.08
110 0.11
111 0.11
112 0.11
113 0.13
114 0.13
115 0.13
116 0.12
117 0.13
118 0.11
119 0.12
120 0.12
121 0.09
122 0.09
123 0.07
124 0.07
125 0.06
126 0.04
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.04
134 0.04
135 0.04
136 0.05
137 0.06
138 0.12
139 0.16
140 0.21
141 0.21
142 0.23
143 0.25
144 0.24
145 0.25
146 0.24
147 0.24
148 0.24
149 0.23
150 0.22
151 0.2
152 0.22
153 0.21
154 0.17
155 0.15
156 0.1
157 0.1
158 0.09
159 0.12
160 0.11
161 0.09
162 0.09
163 0.08
164 0.08
165 0.1
166 0.1
167 0.07
168 0.07
169 0.07
170 0.08
171 0.08
172 0.07
173 0.07
174 0.08
175 0.14
176 0.14
177 0.14
178 0.13
179 0.13
180 0.16
181 0.15
182 0.15
183 0.1
184 0.12
185 0.13
186 0.15
187 0.18
188 0.17
189 0.19
190 0.19
191 0.2
192 0.22
193 0.21
194 0.21
195 0.18
196 0.18
197 0.18
198 0.19
199 0.21
200 0.19
201 0.19
202 0.17
203 0.17
204 0.19
205 0.23
206 0.23
207 0.24
208 0.28
209 0.33
210 0.34
211 0.36
212 0.33
213 0.27
214 0.27
215 0.26
216 0.23
217 0.19
218 0.19
219 0.18
220 0.2
221 0.2
222 0.18
223 0.15
224 0.12
225 0.11
226 0.09
227 0.08
228 0.05
229 0.06
230 0.06
231 0.05
232 0.06
233 0.06
234 0.07
235 0.08
236 0.1
237 0.13
238 0.17
239 0.18
240 0.18
241 0.18
242 0.17
243 0.17
244 0.15
245 0.12
246 0.11
247 0.13
248 0.13
249 0.12
250 0.13
251 0.12
252 0.12
253 0.11
254 0.11
255 0.09
256 0.12
257 0.15
258 0.14
259 0.14
260 0.13
261 0.13
262 0.12
263 0.13
264 0.1
265 0.09
266 0.09
267 0.09
268 0.08
269 0.1
270 0.09
271 0.08
272 0.08
273 0.08
274 0.08
275 0.09
276 0.1
277 0.1
278 0.12