Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VBE9

Protein Details
Accession A0A397VBE9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-70SVNPKDFLSRKCKKGKKPSKSSNAFMIYRKMFSRELRKKNYKIKITHydrophilic
NLS Segment(s)
PositionSequence
37-44KKGKKPSK
Subcellular Location(s) nucl 16, cyto_nucl 11.333, mito_nucl 10.333, cyto 5.5, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Pfam View protein in Pfam  
PF00505  HMG_box  
Amino Acid Sequences MTSLKKKMENSQNIDNEIHVPYPCSVNPKDFLSRKCKKGKKPSKSSNAFMIYRKMFSRELRKKNYKIKITQAKISGMASASWKNESNHIKDAYHKLAGDVDRLFMELHQENPNEGSIERIDPNKENGELSPIPNQLPNVSAENIYNIANHDIIYLDAPIPQYYWPVPFTWRYTYDVTNMTYYFSPNYEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.52
3 0.44
4 0.36
5 0.31
6 0.21
7 0.18
8 0.16
9 0.19
10 0.19
11 0.23
12 0.23
13 0.25
14 0.28
15 0.31
16 0.39
17 0.42
18 0.47
19 0.51
20 0.58
21 0.62
22 0.7
23 0.74
24 0.75
25 0.81
26 0.85
27 0.86
28 0.89
29 0.9
30 0.91
31 0.89
32 0.82
33 0.79
34 0.74
35 0.66
36 0.57
37 0.54
38 0.44
39 0.4
40 0.37
41 0.32
42 0.29
43 0.32
44 0.41
45 0.45
46 0.53
47 0.6
48 0.69
49 0.73
50 0.79
51 0.82
52 0.79
53 0.74
54 0.75
55 0.75
56 0.69
57 0.66
58 0.6
59 0.52
60 0.45
61 0.39
62 0.3
63 0.2
64 0.17
65 0.14
66 0.13
67 0.12
68 0.13
69 0.15
70 0.14
71 0.21
72 0.24
73 0.26
74 0.29
75 0.3
76 0.28
77 0.3
78 0.34
79 0.3
80 0.27
81 0.23
82 0.19
83 0.2
84 0.2
85 0.19
86 0.14
87 0.12
88 0.1
89 0.11
90 0.11
91 0.07
92 0.11
93 0.09
94 0.12
95 0.14
96 0.15
97 0.14
98 0.15
99 0.16
100 0.13
101 0.12
102 0.11
103 0.09
104 0.1
105 0.12
106 0.13
107 0.15
108 0.15
109 0.19
110 0.19
111 0.19
112 0.17
113 0.16
114 0.21
115 0.2
116 0.2
117 0.22
118 0.21
119 0.21
120 0.22
121 0.22
122 0.16
123 0.16
124 0.17
125 0.15
126 0.15
127 0.15
128 0.14
129 0.15
130 0.15
131 0.14
132 0.12
133 0.11
134 0.11
135 0.11
136 0.11
137 0.09
138 0.08
139 0.08
140 0.09
141 0.08
142 0.07
143 0.08
144 0.09
145 0.09
146 0.1
147 0.1
148 0.12
149 0.12
150 0.15
151 0.15
152 0.15
153 0.19
154 0.23
155 0.27
156 0.3
157 0.32
158 0.33
159 0.36
160 0.37
161 0.37
162 0.36
163 0.34
164 0.31
165 0.29
166 0.27
167 0.24
168 0.24
169 0.21
170 0.18