Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UPN2

Protein Details
Accession A0A397UPN2    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
66-86EMRLAEKRKKEEEQKKQSNNVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13.333, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008698  NDUB7  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005758  C:mitochondrial intermembrane space  
GO:0070469  C:respirasome  
Pfam View protein in Pfam  
PF05676  NDUF_B7  
Amino Acid Sequences MTSKDDEKPIMIATQKEMEEAHLPLEWRDFCAHLLIPLNKCRNKNNYLPWKCENERHVYEKCQYDEMRLAEKRKKEEEQKKQSNNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.23
4 0.21
5 0.2
6 0.2
7 0.19
8 0.17
9 0.13
10 0.13
11 0.13
12 0.17
13 0.14
14 0.14
15 0.14
16 0.14
17 0.13
18 0.15
19 0.14
20 0.12
21 0.17
22 0.18
23 0.2
24 0.26
25 0.32
26 0.34
27 0.36
28 0.4
29 0.41
30 0.43
31 0.46
32 0.5
33 0.54
34 0.55
35 0.59
36 0.57
37 0.59
38 0.56
39 0.55
40 0.49
41 0.45
42 0.46
43 0.45
44 0.44
45 0.41
46 0.44
47 0.44
48 0.43
49 0.4
50 0.36
51 0.34
52 0.37
53 0.36
54 0.38
55 0.37
56 0.42
57 0.42
58 0.48
59 0.51
60 0.52
61 0.59
62 0.62
63 0.68
64 0.73
65 0.78
66 0.83