Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UN31

Protein Details
Accession A0A397UN31    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
164-188ILYNWIGRKKNQLRNRFQKRLSEIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 12, mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MQTSLNARCRLVPLSCIYGGLTVHCLYGGFGNSKLINHDYYRPRVHKTRMAICLNCWKLIQVNDEKPKKLKTGDGSAIIIQNAWRRFKERDLSNARLAWLSLPNDNTLDDKKFLGLTPCKVKNPISLDQIKMRFNKEYAKYIKKYNRLPYITESEISTYQEYIILYNWIGRKKNQLRNRFQKRLSEIEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.28
4 0.25
5 0.23
6 0.21
7 0.18
8 0.17
9 0.12
10 0.12
11 0.11
12 0.11
13 0.09
14 0.11
15 0.13
16 0.11
17 0.11
18 0.15
19 0.16
20 0.16
21 0.19
22 0.19
23 0.19
24 0.2
25 0.28
26 0.31
27 0.37
28 0.45
29 0.46
30 0.5
31 0.54
32 0.58
33 0.57
34 0.58
35 0.59
36 0.6
37 0.63
38 0.57
39 0.53
40 0.57
41 0.52
42 0.45
43 0.37
44 0.29
45 0.25
46 0.27
47 0.3
48 0.27
49 0.34
50 0.42
51 0.46
52 0.47
53 0.47
54 0.47
55 0.45
56 0.39
57 0.36
58 0.32
59 0.36
60 0.37
61 0.36
62 0.34
63 0.32
64 0.31
65 0.25
66 0.2
67 0.13
68 0.15
69 0.15
70 0.16
71 0.16
72 0.19
73 0.21
74 0.26
75 0.33
76 0.31
77 0.38
78 0.43
79 0.47
80 0.46
81 0.44
82 0.4
83 0.32
84 0.29
85 0.21
86 0.16
87 0.13
88 0.12
89 0.12
90 0.12
91 0.12
92 0.13
93 0.14
94 0.13
95 0.13
96 0.13
97 0.12
98 0.12
99 0.12
100 0.12
101 0.17
102 0.18
103 0.21
104 0.28
105 0.32
106 0.32
107 0.35
108 0.35
109 0.36
110 0.39
111 0.39
112 0.38
113 0.38
114 0.39
115 0.43
116 0.46
117 0.44
118 0.41
119 0.38
120 0.34
121 0.32
122 0.38
123 0.35
124 0.4
125 0.43
126 0.49
127 0.49
128 0.56
129 0.63
130 0.63
131 0.67
132 0.68
133 0.7
134 0.64
135 0.65
136 0.61
137 0.6
138 0.53
139 0.46
140 0.37
141 0.31
142 0.29
143 0.28
144 0.23
145 0.16
146 0.14
147 0.15
148 0.14
149 0.12
150 0.11
151 0.11
152 0.1
153 0.14
154 0.18
155 0.22
156 0.25
157 0.26
158 0.37
159 0.46
160 0.56
161 0.61
162 0.68
163 0.73
164 0.81
165 0.9
166 0.89
167 0.84
168 0.84
169 0.81