Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397U7G0

Protein Details
Accession A0A397U7G0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRKSEERRKMGRRSNWIVRSBasic
NLS Segment(s)
PositionSequence
8-10RRK
Subcellular Location(s) nucl 23.5, mito_nucl 13.666, cyto_nucl 13.333
Family & Domain DBs
Amino Acid Sequences MKRKSEERRKMGRRSNWIVRSVTNSNKYEFGAGEAGSVWMDDHRTKFLKEADLKLPKVLKNMLVKFIKKTIELFKTAGRPKRPRDINQRALSGCMSIPKKAKNEKACAKVNDEQQDPESPCSGSLSSESLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.8
4 0.76
5 0.68
6 0.59
7 0.57
8 0.53
9 0.52
10 0.5
11 0.45
12 0.42
13 0.41
14 0.4
15 0.34
16 0.28
17 0.22
18 0.16
19 0.14
20 0.12
21 0.11
22 0.1
23 0.09
24 0.09
25 0.06
26 0.05
27 0.07
28 0.09
29 0.1
30 0.14
31 0.16
32 0.16
33 0.2
34 0.22
35 0.27
36 0.29
37 0.32
38 0.37
39 0.41
40 0.41
41 0.41
42 0.42
43 0.35
44 0.34
45 0.31
46 0.27
47 0.29
48 0.29
49 0.34
50 0.34
51 0.33
52 0.32
53 0.35
54 0.31
55 0.24
56 0.25
57 0.25
58 0.24
59 0.25
60 0.25
61 0.25
62 0.31
63 0.36
64 0.4
65 0.42
66 0.46
67 0.49
68 0.58
69 0.62
70 0.63
71 0.69
72 0.73
73 0.74
74 0.72
75 0.71
76 0.62
77 0.56
78 0.48
79 0.37
80 0.27
81 0.24
82 0.21
83 0.2
84 0.24
85 0.28
86 0.36
87 0.43
88 0.52
89 0.54
90 0.62
91 0.67
92 0.71
93 0.73
94 0.69
95 0.68
96 0.65
97 0.64
98 0.61
99 0.54
100 0.49
101 0.43
102 0.47
103 0.43
104 0.4
105 0.33
106 0.27
107 0.25
108 0.25
109 0.23
110 0.17
111 0.16