Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397V3N8

Protein Details
Accession A0A397V3N8    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-36LEEFARKYRKDIRKNPMFRARFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR016689  ESCRT-2_cplx_Snf8  
IPR040608  Snf8/Vps36  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0000814  C:ESCRT II complex  
GO:0071985  P:multivesicular body sorting pathway  
Pfam View protein in Pfam  
PF04157  EAP30  
Amino Acid Sequences MQQLRDQLQVFKTNLEEFARKYRKDIRKNPMFRARFQKMCSNIGVDPLASNKGFWAEFLGVGDFYYELGVQIIEICLSTRGRNGGLVDLDELKRQLVKMRGGNNSGISGSNSSQEISDDDIIRSIKTLKPLGNGFEILQIGDRKMVRRKVTSLKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.29
4 0.26
5 0.36
6 0.42
7 0.4
8 0.44
9 0.51
10 0.57
11 0.65
12 0.71
13 0.71
14 0.74
15 0.8
16 0.85
17 0.84
18 0.77
19 0.73
20 0.73
21 0.7
22 0.64
23 0.61
24 0.6
25 0.53
26 0.53
27 0.48
28 0.42
29 0.34
30 0.31
31 0.28
32 0.2
33 0.16
34 0.14
35 0.15
36 0.12
37 0.11
38 0.09
39 0.1
40 0.1
41 0.1
42 0.11
43 0.09
44 0.09
45 0.1
46 0.1
47 0.08
48 0.08
49 0.08
50 0.05
51 0.04
52 0.04
53 0.04
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.04
64 0.05
65 0.06
66 0.06
67 0.08
68 0.08
69 0.09
70 0.1
71 0.1
72 0.1
73 0.1
74 0.1
75 0.11
76 0.11
77 0.1
78 0.1
79 0.09
80 0.09
81 0.09
82 0.13
83 0.15
84 0.21
85 0.25
86 0.31
87 0.35
88 0.37
89 0.38
90 0.34
91 0.3
92 0.25
93 0.21
94 0.15
95 0.14
96 0.12
97 0.12
98 0.12
99 0.11
100 0.11
101 0.11
102 0.11
103 0.12
104 0.14
105 0.14
106 0.14
107 0.16
108 0.16
109 0.16
110 0.16
111 0.15
112 0.14
113 0.19
114 0.23
115 0.23
116 0.28
117 0.3
118 0.32
119 0.33
120 0.32
121 0.27
122 0.26
123 0.24
124 0.19
125 0.2
126 0.18
127 0.15
128 0.19
129 0.2
130 0.23
131 0.31
132 0.39
133 0.42
134 0.47
135 0.54