Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397V3U3

Protein Details
Accession A0A397V3U3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
125-144FRDLKYNELHEKKRQKRFREBasic
NLS Segment(s)
PositionSequence
138-140RQK
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, cyto 9.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001870  B30.2/SPRY  
IPR043136  B30.2/SPRY_sf  
IPR013320  ConA-like_dom_sf  
IPR003877  SPRY_dom  
Gene Ontology GO:0030246  F:carbohydrate binding  
Pfam View protein in Pfam  
PF00622  SPRY  
PROSITE View protein in PROSITE  
PS50188  B302_SPRY  
Amino Acid Sequences MVPITWNVNDKSTHLNVDLNGYGVNYTGRGKNIEDAVIRTTNPIPLQCRLFYFEIDIINNDDGRYKTFLDSWGYHSDDGNFFDCSEIEEPYGPTFKTGDTIGCCLDFRNNTVFYTKNGLNLGIVFRDLKYNELHEKKRQKRFRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.25
4 0.28
5 0.26
6 0.2
7 0.17
8 0.15
9 0.13
10 0.11
11 0.11
12 0.08
13 0.1
14 0.11
15 0.13
16 0.15
17 0.16
18 0.19
19 0.2
20 0.22
21 0.21
22 0.2
23 0.22
24 0.21
25 0.2
26 0.19
27 0.18
28 0.18
29 0.18
30 0.2
31 0.19
32 0.21
33 0.25
34 0.23
35 0.24
36 0.25
37 0.25
38 0.22
39 0.21
40 0.19
41 0.17
42 0.17
43 0.16
44 0.14
45 0.13
46 0.13
47 0.11
48 0.11
49 0.1
50 0.11
51 0.13
52 0.11
53 0.11
54 0.12
55 0.14
56 0.16
57 0.17
58 0.19
59 0.21
60 0.21
61 0.21
62 0.2
63 0.19
64 0.17
65 0.17
66 0.15
67 0.11
68 0.1
69 0.1
70 0.1
71 0.11
72 0.11
73 0.09
74 0.08
75 0.09
76 0.1
77 0.1
78 0.12
79 0.1
80 0.1
81 0.09
82 0.09
83 0.1
84 0.1
85 0.12
86 0.12
87 0.14
88 0.14
89 0.14
90 0.14
91 0.13
92 0.17
93 0.16
94 0.16
95 0.19
96 0.2
97 0.2
98 0.23
99 0.23
100 0.21
101 0.26
102 0.24
103 0.23
104 0.23
105 0.22
106 0.2
107 0.2
108 0.2
109 0.14
110 0.15
111 0.12
112 0.11
113 0.16
114 0.16
115 0.17
116 0.18
117 0.23
118 0.32
119 0.4
120 0.46
121 0.51
122 0.61
123 0.69
124 0.78