Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397V1T0

Protein Details
Accession A0A397V1T0    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-26FLNLTKAKTFKPKKNVPEGSKQHQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11.5, cyto 8.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005301  MOB_kinase_act_fam  
IPR036703  MOB_kinase_act_sf  
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF03637  Mob1_phocein  
Amino Acid Sequences MNFLNLTKAKTFKPKKNVPEGSKQHQLQKYAEATLGSGNLRLAVVLPDGEILDEWLAVNTYDFFNQINMLYGTITEFCTPQLCPVMSAGPKYEYHWSDGDKYKKPTKLSAPEYVDHLMEWVQQQLDDESVFPSKIGDPFPPNFQALVKNIFKRLFRVYAHIYLSHISVIEALEEEAHLNTSFKHFIYFVQEFQLIEKRELQPLADLIASLTSQDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.81
4 0.87
5 0.82
6 0.83
7 0.82
8 0.79
9 0.79
10 0.73
11 0.71
12 0.66
13 0.63
14 0.54
15 0.53
16 0.49
17 0.4
18 0.38
19 0.29
20 0.25
21 0.21
22 0.21
23 0.14
24 0.12
25 0.1
26 0.09
27 0.09
28 0.08
29 0.08
30 0.07
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.04
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.07
50 0.07
51 0.07
52 0.08
53 0.08
54 0.09
55 0.09
56 0.09
57 0.08
58 0.08
59 0.08
60 0.08
61 0.09
62 0.07
63 0.07
64 0.07
65 0.08
66 0.09
67 0.09
68 0.12
69 0.11
70 0.11
71 0.12
72 0.16
73 0.15
74 0.16
75 0.15
76 0.14
77 0.15
78 0.16
79 0.21
80 0.18
81 0.2
82 0.21
83 0.21
84 0.24
85 0.3
86 0.34
87 0.34
88 0.38
89 0.41
90 0.44
91 0.44
92 0.44
93 0.46
94 0.49
95 0.48
96 0.51
97 0.48
98 0.44
99 0.45
100 0.41
101 0.33
102 0.24
103 0.19
104 0.11
105 0.09
106 0.09
107 0.07
108 0.06
109 0.06
110 0.07
111 0.07
112 0.07
113 0.06
114 0.06
115 0.07
116 0.08
117 0.07
118 0.07
119 0.07
120 0.08
121 0.1
122 0.11
123 0.13
124 0.16
125 0.18
126 0.22
127 0.23
128 0.23
129 0.21
130 0.21
131 0.21
132 0.19
133 0.25
134 0.25
135 0.25
136 0.29
137 0.32
138 0.32
139 0.32
140 0.34
141 0.33
142 0.3
143 0.34
144 0.35
145 0.37
146 0.38
147 0.35
148 0.31
149 0.26
150 0.26
151 0.2
152 0.15
153 0.09
154 0.08
155 0.07
156 0.07
157 0.06
158 0.06
159 0.05
160 0.05
161 0.06
162 0.06
163 0.07
164 0.07
165 0.07
166 0.08
167 0.11
168 0.13
169 0.12
170 0.14
171 0.13
172 0.15
173 0.23
174 0.25
175 0.22
176 0.24
177 0.26
178 0.24
179 0.27
180 0.32
181 0.26
182 0.26
183 0.31
184 0.29
185 0.33
186 0.34
187 0.31
188 0.27
189 0.26
190 0.26
191 0.19
192 0.17
193 0.12
194 0.13
195 0.12