Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397WAZ2

Protein Details
Accession A0A397WAZ2    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPHSIEKRQTKRTRNNKCKIKLDLNSHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito_nucl 12.833, cyto_nucl 11.833, mito 3.5
Family & Domain DBs
Amino Acid Sequences MPHSIEKRQTKRTRNNKCKIKLDLNSHIEDNENTSPSQRRRIENSALEELFKEQNISWNRKEFVKECQSRNIRLDDNDIVNTTKLISWFDRKKYKTKSLMVLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.92
3 0.91
4 0.9
5 0.88
6 0.86
7 0.84
8 0.81
9 0.78
10 0.77
11 0.72
12 0.65
13 0.57
14 0.49
15 0.4
16 0.32
17 0.29
18 0.21
19 0.17
20 0.15
21 0.17
22 0.23
23 0.24
24 0.34
25 0.34
26 0.36
27 0.41
28 0.47
29 0.51
30 0.49
31 0.52
32 0.47
33 0.42
34 0.38
35 0.31
36 0.27
37 0.21
38 0.16
39 0.12
40 0.07
41 0.14
42 0.19
43 0.24
44 0.24
45 0.28
46 0.29
47 0.31
48 0.34
49 0.28
50 0.33
51 0.38
52 0.42
53 0.41
54 0.49
55 0.51
56 0.53
57 0.54
58 0.5
59 0.43
60 0.38
61 0.41
62 0.34
63 0.33
64 0.29
65 0.27
66 0.23
67 0.21
68 0.19
69 0.15
70 0.12
71 0.11
72 0.13
73 0.16
74 0.24
75 0.31
76 0.4
77 0.49
78 0.52
79 0.61
80 0.67
81 0.74
82 0.74
83 0.74