Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VZV1

Protein Details
Accession A0A397VZV1    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21RPKKNRNRQKIPRPQNPFVIFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13, nucl 12.5, mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences RPKKNRNRQKIPRPQNPFVIFRRDAQAKMEAGIESEMKESMLALVSKTAGKDWKTADAEVKNVFNYLATLAKKVHEKTYPDYVYKPRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.78
4 0.73
5 0.66
6 0.63
7 0.54
8 0.47
9 0.49
10 0.42
11 0.37
12 0.33
13 0.34
14 0.26
15 0.25
16 0.24
17 0.17
18 0.15
19 0.15
20 0.12
21 0.09
22 0.09
23 0.08
24 0.06
25 0.06
26 0.05
27 0.05
28 0.06
29 0.05
30 0.05
31 0.05
32 0.06
33 0.06
34 0.07
35 0.08
36 0.1
37 0.11
38 0.14
39 0.15
40 0.22
41 0.23
42 0.24
43 0.29
44 0.26
45 0.28
46 0.27
47 0.27
48 0.2
49 0.19
50 0.17
51 0.12
52 0.11
53 0.1
54 0.13
55 0.13
56 0.14
57 0.15
58 0.18
59 0.24
60 0.26
61 0.31
62 0.32
63 0.36
64 0.4
65 0.5
66 0.51
67 0.48
68 0.52