Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UBC9

Protein Details
Accession A0A397UBC9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-41NYGNFGKKKNAPVKKAKAKKKACFEKIGFHydrophilic
NLS Segment(s)
PositionSequence
18-33GKKKNAPVKKAKAKKK
Subcellular Location(s) nucl 16, mito 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MKQTKLFSKTFKNYGNFGKKKNAPVKKAKAKKKACFEKIGFNRFFKRQEECRNMSHNNLDTWIKGQLASFAYSDNSTTQNRIKYQYRYDNQNIVYLSTYLILITISSCRLDRNKAHIKNNEWLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.69
3 0.64
4 0.61
5 0.63
6 0.61
7 0.67
8 0.72
9 0.7
10 0.68
11 0.73
12 0.8
13 0.8
14 0.85
15 0.85
16 0.85
17 0.87
18 0.87
19 0.87
20 0.87
21 0.82
22 0.81
23 0.73
24 0.73
25 0.71
26 0.71
27 0.63
28 0.56
29 0.55
30 0.5
31 0.52
32 0.44
33 0.42
34 0.42
35 0.49
36 0.53
37 0.52
38 0.53
39 0.54
40 0.53
41 0.48
42 0.45
43 0.36
44 0.28
45 0.27
46 0.23
47 0.17
48 0.17
49 0.15
50 0.11
51 0.09
52 0.09
53 0.1
54 0.1
55 0.11
56 0.1
57 0.1
58 0.1
59 0.1
60 0.11
61 0.09
62 0.11
63 0.11
64 0.14
65 0.17
66 0.21
67 0.23
68 0.28
69 0.32
70 0.35
71 0.43
72 0.5
73 0.51
74 0.55
75 0.57
76 0.58
77 0.53
78 0.52
79 0.44
80 0.35
81 0.31
82 0.23
83 0.19
84 0.13
85 0.12
86 0.08
87 0.07
88 0.06
89 0.05
90 0.05
91 0.06
92 0.07
93 0.09
94 0.09
95 0.13
96 0.17
97 0.24
98 0.29
99 0.38
100 0.48
101 0.55
102 0.64
103 0.68
104 0.7