Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UA72

Protein Details
Accession A0A397UA72    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
99-127EVTHAHKTRAVKKRPIRKRKVKGKVNYRABasic
NLS Segment(s)
PositionSequence
105-124KTRAVKKRPIRKRKVKGKVN
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences NNWFYGRKYDDDELQTYIPEIVTDAEDAWVRTTLRIKNLTEKKGERVIVSVNKRDTHDFYKILPGKSKDSGTSNSDTSSNSDTSDSDSSNSSTSSSEIEVTHAHKTRAVKKRPIRKRKVKGKVNYRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.25
4 0.22
5 0.16
6 0.11
7 0.1
8 0.07
9 0.08
10 0.08
11 0.07
12 0.08
13 0.09
14 0.09
15 0.1
16 0.11
17 0.11
18 0.12
19 0.18
20 0.19
21 0.25
22 0.3
23 0.3
24 0.38
25 0.46
26 0.48
27 0.5
28 0.49
29 0.48
30 0.49
31 0.48
32 0.38
33 0.32
34 0.33
35 0.33
36 0.35
37 0.36
38 0.32
39 0.33
40 0.34
41 0.35
42 0.34
43 0.31
44 0.31
45 0.27
46 0.25
47 0.32
48 0.35
49 0.33
50 0.33
51 0.31
52 0.3
53 0.32
54 0.32
55 0.24
56 0.24
57 0.26
58 0.25
59 0.26
60 0.23
61 0.21
62 0.21
63 0.19
64 0.19
65 0.18
66 0.15
67 0.13
68 0.13
69 0.13
70 0.16
71 0.17
72 0.15
73 0.13
74 0.14
75 0.14
76 0.14
77 0.14
78 0.11
79 0.1
80 0.1
81 0.11
82 0.1
83 0.11
84 0.1
85 0.12
86 0.14
87 0.15
88 0.22
89 0.23
90 0.23
91 0.25
92 0.31
93 0.4
94 0.48
95 0.54
96 0.57
97 0.64
98 0.75
99 0.82
100 0.87
101 0.88
102 0.9
103 0.92
104 0.93
105 0.94
106 0.94
107 0.93