Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TRQ3

Protein Details
Accession A0A397TRQ3    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-55NLQKRRVSKRIESKVENNKNKKKETETYQYDKEKAPTPKKNKRQRVPKKTSSTTHydrophilic
NLS Segment(s)
PositionSequence
10-11KR
19-23NKNKK
34-50EKAPTPKKNKRQRVPKK
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MNLQKRRVSKRIESKVENNKNKKKETETYQYDKEKAPTPKKNKRQRVPKKTSSTTPTTEMNINNRTTEINDFKPKWSSTIREQHTNDARNENSPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.84
4 0.84
5 0.84
6 0.82
7 0.81
8 0.8
9 0.76
10 0.72
11 0.69
12 0.67
13 0.67
14 0.66
15 0.65
16 0.66
17 0.64
18 0.59
19 0.53
20 0.48
21 0.45
22 0.46
23 0.49
24 0.51
25 0.58
26 0.66
27 0.75
28 0.83
29 0.86
30 0.86
31 0.88
32 0.89
33 0.9
34 0.89
35 0.88
36 0.86
37 0.8
38 0.76
39 0.7
40 0.63
41 0.55
42 0.49
43 0.41
44 0.34
45 0.33
46 0.29
47 0.3
48 0.29
49 0.27
50 0.25
51 0.24
52 0.22
53 0.21
54 0.25
55 0.24
56 0.25
57 0.33
58 0.34
59 0.36
60 0.41
61 0.39
62 0.38
63 0.39
64 0.38
65 0.39
66 0.48
67 0.51
68 0.55
69 0.57
70 0.62
71 0.66
72 0.66
73 0.6
74 0.57
75 0.54