Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U4Q0

Protein Details
Accession A0A397U4Q0    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-45RYDSRRRKAHYDSRRKEAQKBasic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 5.5, cyto_mito 4.5, plas 4, golg 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003953  FAD-binding_2  
IPR036188  FAD/NAD-bd_sf  
IPR027477  Succ_DH/fumarate_Rdtase_cat_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00890  FAD_binding_2  
Amino Acid Sequences MSLKSSGVSVSTPSIRHYDPERREARYDSRRRKAHYDSRRKEAQKYTTGETKIGISASQLKATFDDYNDIASNKKKDPFGKKFFYNFLITINDQFHVALMSPVLHYTIGGIDINAESEVRDMQEQVIPGLFEKFQTLILELFGFLGGLIPTIHLVSSAVFLFPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.26
4 0.32
5 0.37
6 0.4
7 0.49
8 0.51
9 0.52
10 0.55
11 0.56
12 0.59
13 0.6
14 0.65
15 0.66
16 0.71
17 0.73
18 0.75
19 0.78
20 0.78
21 0.77
22 0.78
23 0.79
24 0.75
25 0.76
26 0.8
27 0.75
28 0.72
29 0.7
30 0.67
31 0.63
32 0.61
33 0.58
34 0.55
35 0.53
36 0.46
37 0.38
38 0.31
39 0.24
40 0.2
41 0.15
42 0.1
43 0.15
44 0.16
45 0.18
46 0.17
47 0.16
48 0.17
49 0.2
50 0.19
51 0.13
52 0.15
53 0.12
54 0.13
55 0.14
56 0.13
57 0.12
58 0.15
59 0.18
60 0.18
61 0.21
62 0.23
63 0.29
64 0.39
65 0.47
66 0.51
67 0.53
68 0.54
69 0.53
70 0.52
71 0.48
72 0.4
73 0.31
74 0.26
75 0.23
76 0.2
77 0.19
78 0.17
79 0.14
80 0.12
81 0.12
82 0.1
83 0.07
84 0.07
85 0.05
86 0.04
87 0.05
88 0.04
89 0.05
90 0.05
91 0.05
92 0.04
93 0.05
94 0.05
95 0.06
96 0.05
97 0.05
98 0.05
99 0.05
100 0.06
101 0.06
102 0.06
103 0.04
104 0.05
105 0.06
106 0.06
107 0.07
108 0.06
109 0.08
110 0.1
111 0.1
112 0.1
113 0.1
114 0.1
115 0.1
116 0.11
117 0.1
118 0.08
119 0.1
120 0.1
121 0.11
122 0.11
123 0.12
124 0.11
125 0.12
126 0.11
127 0.1
128 0.1
129 0.08
130 0.07
131 0.05
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.08
144 0.08