Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397V509

Protein Details
Accession A0A397V509    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-36GNNVFFNIKKKEKKTRNKDIDLNICEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 7, mito 5
Family & Domain DBs
Amino Acid Sequences MAPNARIEAYGNNVFFNIKKKEKKTRNKDIDLNICENLNENSEMISLNESIDLNVNKDKNSEITPLDQSLDLTINEDKNSEIIPATSTIKGNKGKGKALSWVFAEEHFTKLPSYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.27
4 0.29
5 0.33
6 0.41
7 0.49
8 0.6
9 0.7
10 0.79
11 0.83
12 0.86
13 0.87
14 0.86
15 0.85
16 0.83
17 0.82
18 0.75
19 0.68
20 0.57
21 0.47
22 0.39
23 0.33
24 0.25
25 0.17
26 0.13
27 0.09
28 0.09
29 0.09
30 0.09
31 0.08
32 0.08
33 0.06
34 0.06
35 0.07
36 0.06
37 0.06
38 0.09
39 0.09
40 0.09
41 0.12
42 0.12
43 0.12
44 0.12
45 0.13
46 0.12
47 0.14
48 0.14
49 0.12
50 0.15
51 0.16
52 0.16
53 0.16
54 0.14
55 0.13
56 0.11
57 0.11
58 0.08
59 0.09
60 0.1
61 0.1
62 0.11
63 0.11
64 0.1
65 0.1
66 0.1
67 0.09
68 0.07
69 0.06
70 0.07
71 0.09
72 0.12
73 0.13
74 0.14
75 0.15
76 0.22
77 0.27
78 0.31
79 0.35
80 0.37
81 0.41
82 0.43
83 0.44
84 0.45
85 0.43
86 0.42
87 0.37
88 0.36
89 0.31
90 0.27
91 0.31
92 0.24
93 0.25
94 0.22
95 0.22