Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397URH8

Protein Details
Accession A0A397URH8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
42-93VKNKNYQKNKNYQKNKNYQKNKNYQKNKNYQKNKNYQKNKNYQVNKNYQVNKHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, pero 3, E.R. 3, cyto 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLSKFYLVFIIASVFTAIVINSAPFDRDEKEGKERPERPVDVKNKNYQKNKNYQKNKNYQKNKNYQKNKNYQKNKNYQKNKNYQVNKNYQVNKSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.06
5 0.05
6 0.05
7 0.05
8 0.06
9 0.06
10 0.07
11 0.07
12 0.09
13 0.11
14 0.14
15 0.18
16 0.21
17 0.29
18 0.33
19 0.37
20 0.45
21 0.47
22 0.49
23 0.53
24 0.51
25 0.48
26 0.52
27 0.56
28 0.55
29 0.56
30 0.59
31 0.6
32 0.65
33 0.69
34 0.68
35 0.66
36 0.68
37 0.74
38 0.76
39 0.77
40 0.79
41 0.8
42 0.82
43 0.86
44 0.86
45 0.86
46 0.85
47 0.84
48 0.85
49 0.86
50 0.86
51 0.86
52 0.85
53 0.84
54 0.85
55 0.86
56 0.86
57 0.86
58 0.85
59 0.84
60 0.85
61 0.86
62 0.86
63 0.86
64 0.85
65 0.84
66 0.85
67 0.86
68 0.86
69 0.85
70 0.84
71 0.84
72 0.84
73 0.83
74 0.81
75 0.79