Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397U7S8

Protein Details
Accession A0A397U7S8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-24TTTKTETKSKPKAEAKEKKPHydrophilic
NLS Segment(s)
PositionSequence
14-23KPKAEAKEKK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MGKTTTTKTETKSKPKAEAKEKKPPNAYNLYVQKQLPKLKAENPGLDHKAVFKLVAEHWAKSAENPKNKNQSQKQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.78
4 0.78
5 0.8
6 0.77
7 0.78
8 0.8
9 0.77
10 0.77
11 0.71
12 0.66
13 0.62
14 0.57
15 0.55
16 0.56
17 0.51
18 0.46
19 0.43
20 0.41
21 0.39
22 0.42
23 0.36
24 0.31
25 0.31
26 0.32
27 0.4
28 0.39
29 0.37
30 0.36
31 0.39
32 0.38
33 0.36
34 0.31
35 0.24
36 0.22
37 0.2
38 0.16
39 0.1
40 0.11
41 0.11
42 0.2
43 0.2
44 0.19
45 0.2
46 0.22
47 0.22
48 0.23
49 0.32
50 0.32
51 0.4
52 0.44
53 0.52
54 0.61
55 0.65
56 0.73