Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UVR1

Protein Details
Accession A0A397UVR1    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-35QGPVKIWKQINPNKSNKYKFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR001440  TPR_1  
IPR013105  TPR_2  
IPR019734  TPR_repeat  
Pfam View protein in Pfam  
PF00515  TPR_1  
PF13432  TPR_16  
PF07719  TPR_2  
PF13181  TPR_8  
PROSITE View protein in PROSITE  
PS50005  TPR  
PS50293  TPR_REGION  
Amino Acid Sequences MSPVIRFTTSADLRQGPVKIWKQINPNKSNKYKFLSFFIKFSIFIGQKLLKIRQKKYDEALKDINKALEIDPNNSYALWVRGEVNLKKENFDEAFEDLNKALEIDPNNLCALEARGEANFMNDKNDEALKDLDKTLEIYPNNSHALVLRGYVYYFQDDYDEVLKNLNKALEINPSDVFALRIRGDAYIGQDKFEEALKDLDKGLEINPNNTYALRARGRAYKSLKKYKESIPDLTKSLETEPDNVLALNCRAESYRELREFDKALKDVNQALQNSPNDPDSLTIRLDIYKSMRKYEAALTDSNELMKLCPHCSRCPCANHIGARGNIYRLMGKYEEAHKDLNRALEQDPKNIYALSIRGRLYGVLDKYEDALKDINKLLEIVPNDIWALTTRGDVYRRQGNFNAAIIDLNKALKIDPEHSFALRIRGMTYYSLNKHKDAIRDLDKSLKVEKDRDFKIKMLNIYHRMGLYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.31
4 0.37
5 0.39
6 0.43
7 0.47
8 0.51
9 0.57
10 0.64
11 0.72
12 0.71
13 0.75
14 0.77
15 0.81
16 0.82
17 0.79
18 0.78
19 0.75
20 0.68
21 0.66
22 0.66
23 0.58
24 0.53
25 0.51
26 0.45
27 0.37
28 0.35
29 0.36
30 0.28
31 0.26
32 0.3
33 0.27
34 0.29
35 0.35
36 0.42
37 0.4
38 0.48
39 0.54
40 0.58
41 0.62
42 0.65
43 0.67
44 0.68
45 0.65
46 0.64
47 0.67
48 0.61
49 0.59
50 0.55
51 0.48
52 0.39
53 0.37
54 0.3
55 0.28
56 0.26
57 0.25
58 0.24
59 0.24
60 0.24
61 0.22
62 0.22
63 0.16
64 0.16
65 0.14
66 0.13
67 0.13
68 0.17
69 0.24
70 0.26
71 0.3
72 0.35
73 0.34
74 0.35
75 0.34
76 0.36
77 0.3
78 0.29
79 0.26
80 0.21
81 0.24
82 0.23
83 0.23
84 0.17
85 0.17
86 0.15
87 0.13
88 0.11
89 0.12
90 0.13
91 0.16
92 0.17
93 0.18
94 0.18
95 0.17
96 0.17
97 0.13
98 0.13
99 0.11
100 0.11
101 0.1
102 0.1
103 0.12
104 0.12
105 0.13
106 0.15
107 0.13
108 0.15
109 0.14
110 0.15
111 0.16
112 0.18
113 0.15
114 0.15
115 0.17
116 0.15
117 0.17
118 0.17
119 0.15
120 0.14
121 0.16
122 0.16
123 0.19
124 0.18
125 0.19
126 0.2
127 0.23
128 0.24
129 0.22
130 0.2
131 0.14
132 0.16
133 0.14
134 0.13
135 0.11
136 0.09
137 0.1
138 0.11
139 0.11
140 0.11
141 0.11
142 0.1
143 0.1
144 0.1
145 0.12
146 0.13
147 0.13
148 0.11
149 0.14
150 0.15
151 0.14
152 0.16
153 0.14
154 0.12
155 0.12
156 0.14
157 0.18
158 0.19
159 0.21
160 0.19
161 0.19
162 0.19
163 0.18
164 0.18
165 0.11
166 0.12
167 0.1
168 0.11
169 0.1
170 0.1
171 0.11
172 0.11
173 0.14
174 0.18
175 0.18
176 0.18
177 0.17
178 0.17
179 0.17
180 0.18
181 0.14
182 0.08
183 0.11
184 0.11
185 0.12
186 0.12
187 0.12
188 0.1
189 0.11
190 0.1
191 0.14
192 0.14
193 0.14
194 0.15
195 0.16
196 0.16
197 0.16
198 0.16
199 0.11
200 0.17
201 0.17
202 0.18
203 0.19
204 0.25
205 0.27
206 0.33
207 0.38
208 0.4
209 0.47
210 0.56
211 0.57
212 0.54
213 0.57
214 0.56
215 0.59
216 0.55
217 0.53
218 0.47
219 0.46
220 0.44
221 0.41
222 0.34
223 0.25
224 0.21
225 0.19
226 0.15
227 0.15
228 0.15
229 0.14
230 0.14
231 0.13
232 0.12
233 0.09
234 0.09
235 0.07
236 0.07
237 0.06
238 0.07
239 0.08
240 0.11
241 0.14
242 0.2
243 0.22
244 0.24
245 0.24
246 0.27
247 0.27
248 0.26
249 0.27
250 0.2
251 0.19
252 0.2
253 0.21
254 0.2
255 0.23
256 0.25
257 0.21
258 0.22
259 0.26
260 0.24
261 0.23
262 0.22
263 0.19
264 0.15
265 0.14
266 0.15
267 0.11
268 0.13
269 0.12
270 0.11
271 0.11
272 0.12
273 0.12
274 0.13
275 0.15
276 0.2
277 0.21
278 0.23
279 0.24
280 0.23
281 0.25
282 0.28
283 0.29
284 0.26
285 0.25
286 0.24
287 0.25
288 0.24
289 0.22
290 0.18
291 0.12
292 0.1
293 0.12
294 0.12
295 0.13
296 0.19
297 0.22
298 0.28
299 0.33
300 0.39
301 0.43
302 0.45
303 0.47
304 0.47
305 0.49
306 0.46
307 0.47
308 0.45
309 0.4
310 0.39
311 0.36
312 0.31
313 0.26
314 0.24
315 0.21
316 0.16
317 0.19
318 0.15
319 0.15
320 0.18
321 0.23
322 0.26
323 0.26
324 0.29
325 0.27
326 0.29
327 0.3
328 0.32
329 0.26
330 0.25
331 0.24
332 0.3
333 0.31
334 0.33
335 0.33
336 0.3
337 0.3
338 0.27
339 0.26
340 0.18
341 0.2
342 0.19
343 0.21
344 0.21
345 0.21
346 0.21
347 0.21
348 0.22
349 0.25
350 0.22
351 0.19
352 0.19
353 0.19
354 0.2
355 0.22
356 0.19
357 0.15
358 0.17
359 0.15
360 0.18
361 0.2
362 0.19
363 0.17
364 0.18
365 0.17
366 0.18
367 0.19
368 0.19
369 0.17
370 0.17
371 0.17
372 0.15
373 0.15
374 0.12
375 0.13
376 0.1
377 0.11
378 0.12
379 0.15
380 0.18
381 0.2
382 0.24
383 0.31
384 0.33
385 0.37
386 0.38
387 0.4
388 0.4
389 0.39
390 0.35
391 0.26
392 0.26
393 0.21
394 0.2
395 0.16
396 0.14
397 0.13
398 0.11
399 0.11
400 0.14
401 0.17
402 0.2
403 0.21
404 0.26
405 0.28
406 0.28
407 0.31
408 0.29
409 0.31
410 0.28
411 0.26
412 0.22
413 0.22
414 0.23
415 0.22
416 0.25
417 0.28
418 0.32
419 0.4
420 0.42
421 0.42
422 0.46
423 0.47
424 0.5
425 0.48
426 0.51
427 0.5
428 0.51
429 0.53
430 0.56
431 0.54
432 0.5
433 0.5
434 0.48
435 0.45
436 0.48
437 0.54
438 0.54
439 0.58
440 0.63
441 0.61
442 0.57
443 0.61
444 0.6
445 0.58
446 0.58
447 0.6
448 0.58
449 0.58
450 0.57