Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UDA6

Protein Details
Accession A0A397UDA6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
51-77DSKNKAKEPVKKRPYKRKQPSFTRDYFHydrophilic
NLS Segment(s)
PositionSequence
53-68KNKAKEPVKKRPYKRK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MDNYEMIDDDEYYPNDYYYKIAEDSRTSAETFSLAATTPSVQTTYFSKLSDSKNKAKEPVKKRPYKRKQPSFTRDYFDKKVNEKGEEVRVCKIINEEGQKCGIVLQDGEILKKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.14
5 0.13
6 0.15
7 0.14
8 0.15
9 0.17
10 0.19
11 0.22
12 0.24
13 0.24
14 0.21
15 0.2
16 0.18
17 0.16
18 0.14
19 0.11
20 0.08
21 0.06
22 0.06
23 0.06
24 0.07
25 0.07
26 0.07
27 0.08
28 0.07
29 0.08
30 0.11
31 0.15
32 0.16
33 0.15
34 0.16
35 0.21
36 0.26
37 0.34
38 0.37
39 0.4
40 0.46
41 0.47
42 0.52
43 0.54
44 0.58
45 0.57
46 0.63
47 0.65
48 0.68
49 0.75
50 0.8
51 0.84
52 0.86
53 0.89
54 0.88
55 0.88
56 0.9
57 0.89
58 0.85
59 0.78
60 0.73
61 0.67
62 0.63
63 0.57
64 0.52
65 0.49
66 0.45
67 0.49
68 0.48
69 0.45
70 0.4
71 0.41
72 0.44
73 0.44
74 0.43
75 0.37
76 0.35
77 0.33
78 0.31
79 0.29
80 0.25
81 0.26
82 0.32
83 0.31
84 0.31
85 0.32
86 0.31
87 0.29
88 0.25
89 0.2
90 0.14
91 0.12
92 0.12
93 0.16
94 0.17