Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397U3S0

Protein Details
Accession A0A397U3S0    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
41-62AENPTLKRRKGRQPKAHRILSSHydrophilic
NLS Segment(s)
PositionSequence
47-56KRRKGRQPKA
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MNITNSNEENHLVSENVNENKTSNSLDESDETRKRKVLIVAENPTLKRRKGRQPKAHRILSSIENNKNNQQVKQRSIKCTYCHEIGHNIRCCKARLADKANEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.2
3 0.22
4 0.21
5 0.2
6 0.2
7 0.21
8 0.23
9 0.21
10 0.15
11 0.15
12 0.15
13 0.17
14 0.18
15 0.2
16 0.25
17 0.3
18 0.32
19 0.31
20 0.31
21 0.31
22 0.32
23 0.33
24 0.33
25 0.35
26 0.4
27 0.43
28 0.44
29 0.46
30 0.43
31 0.43
32 0.39
33 0.32
34 0.31
35 0.34
36 0.41
37 0.5
38 0.6
39 0.67
40 0.75
41 0.85
42 0.86
43 0.85
44 0.74
45 0.65
46 0.58
47 0.52
48 0.5
49 0.45
50 0.43
51 0.41
52 0.42
53 0.43
54 0.47
55 0.44
56 0.4
57 0.43
58 0.44
59 0.47
60 0.55
61 0.58
62 0.58
63 0.63
64 0.64
65 0.58
66 0.59
67 0.58
68 0.52
69 0.48
70 0.44
71 0.46
72 0.49
73 0.54
74 0.54
75 0.51
76 0.52
77 0.52
78 0.52
79 0.47
80 0.47
81 0.47
82 0.49
83 0.54