Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U2I8

Protein Details
Accession A0A397U2I8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
38-62ESISEFDKKRKKAKVKKSVGRPEDPBasic
NLS Segment(s)
PositionSequence
45-58KKRKKAKVKKSVGR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, mito_nucl 11.166, cyto 4
Family & Domain DBs
Amino Acid Sequences MLSNIKYFFKKHCQNESNNDSQNPENRIDSSKYSTSDESISEFDKKRKKAKVKKSVGRPEDPVNKEYIKLGVRDKHGHVAMKSADIIKKTFFGSQVLSKCQEFVTYFQNSHMPGAQLRDEIKNFLIKGRGLKLSIKTRWCSAWDCCDSVLKLEAVLQNISSFEALELMFRYLILINK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.78
3 0.78
4 0.77
5 0.72
6 0.65
7 0.57
8 0.54
9 0.52
10 0.46
11 0.41
12 0.34
13 0.31
14 0.34
15 0.34
16 0.34
17 0.33
18 0.33
19 0.33
20 0.34
21 0.33
22 0.31
23 0.29
24 0.25
25 0.21
26 0.19
27 0.19
28 0.22
29 0.24
30 0.29
31 0.35
32 0.41
33 0.47
34 0.55
35 0.64
36 0.69
37 0.77
38 0.81
39 0.84
40 0.87
41 0.89
42 0.9
43 0.85
44 0.79
45 0.71
46 0.68
47 0.67
48 0.61
49 0.51
50 0.44
51 0.38
52 0.34
53 0.31
54 0.27
55 0.19
56 0.18
57 0.22
58 0.23
59 0.27
60 0.3
61 0.31
62 0.32
63 0.32
64 0.32
65 0.28
66 0.26
67 0.23
68 0.2
69 0.19
70 0.16
71 0.15
72 0.14
73 0.14
74 0.11
75 0.12
76 0.12
77 0.13
78 0.12
79 0.11
80 0.12
81 0.17
82 0.19
83 0.2
84 0.21
85 0.2
86 0.19
87 0.18
88 0.18
89 0.14
90 0.14
91 0.16
92 0.17
93 0.17
94 0.17
95 0.2
96 0.18
97 0.18
98 0.17
99 0.13
100 0.12
101 0.15
102 0.15
103 0.14
104 0.15
105 0.18
106 0.17
107 0.18
108 0.18
109 0.19
110 0.18
111 0.19
112 0.2
113 0.18
114 0.21
115 0.24
116 0.25
117 0.23
118 0.27
119 0.32
120 0.38
121 0.43
122 0.45
123 0.44
124 0.44
125 0.45
126 0.44
127 0.42
128 0.37
129 0.4
130 0.38
131 0.37
132 0.35
133 0.36
134 0.34
135 0.31
136 0.29
137 0.19
138 0.16
139 0.19
140 0.2
141 0.18
142 0.18
143 0.16
144 0.14
145 0.15
146 0.15
147 0.11
148 0.09
149 0.07
150 0.08
151 0.08
152 0.08
153 0.09
154 0.1
155 0.1
156 0.09
157 0.11