Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UZ58

Protein Details
Accession A0A397UZ58    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-44SLSFAAKKAKKAKKAKKNKDKGKTKEIKEBasic
NLS Segment(s)
PositionSequence
21-41AKKAKKAKKAKKNKDKGKTKE
Subcellular Location(s) mito 21.5, mito_nucl 13.5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MKRFMKSGSNPAMVGSLSFAAKKAKKAKKAKKNKDKGKTKEIKETVERAPLLIELSDRVSPASDVPIAPMTASYEYTSGSGCN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.18
3 0.12
4 0.09
5 0.09
6 0.1
7 0.16
8 0.18
9 0.25
10 0.34
11 0.41
12 0.51
13 0.62
14 0.71
15 0.75
16 0.85
17 0.89
18 0.89
19 0.92
20 0.93
21 0.92
22 0.92
23 0.88
24 0.88
25 0.85
26 0.77
27 0.76
28 0.69
29 0.63
30 0.55
31 0.53
32 0.43
33 0.4
34 0.36
35 0.26
36 0.23
37 0.19
38 0.16
39 0.12
40 0.1
41 0.06
42 0.09
43 0.09
44 0.09
45 0.09
46 0.09
47 0.09
48 0.09
49 0.11
50 0.1
51 0.09
52 0.12
53 0.13
54 0.12
55 0.12
56 0.12
57 0.12
58 0.12
59 0.14
60 0.13
61 0.11
62 0.12
63 0.13