Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UAS7

Protein Details
Accession A0A397UAS7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
322-341EKTKVINKGKQKEVIKKRTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011335  Restrct_endonuc-II-like  
IPR007560  Restrct_endonuc_IV_Mrr  
Gene Ontology GO:0003677  F:DNA binding  
GO:0004519  F:endonuclease activity  
GO:0009307  P:DNA restriction-modification system  
GO:0006302  P:double-strand break repair  
Pfam View protein in Pfam  
PF04471  Mrr_cat  
Amino Acid Sequences MEKKISNYKIGYNFESIIRHKLNSSDMIVANEIKVTQGDCGIDLIATYKKNFVLIQYKSVEKPIAVQTVRNFESSIQRFPNLSLGIIVCDSGKIKDEKYLTFNTSAWVKSSDLNLKVCDERFIVETIINNIIEGNDEEEIVISNIHLDFLSFLNYIFILVMFDPNIWKTINYPAKLNYVNNIHHRYIQNIRYNTSQQIKKHGLIDETIEFFYMIIQKFNSVIGVRFMILSPENAKLCEAMCEEIISHINETTLQVLNEESFNYGEIYNDVDCFLNVLKYFEKYHDLSEEQSNEIYSIISNQYYQSKKQQEYYSESDDSDDSEKTKVINKGKQKEVIKKRTFGDLAELSKVNEPESSKVNGIINELLIKRSRAKTEYLGSEFLNVSRRVSRSLYRPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.39
4 0.4
5 0.37
6 0.35
7 0.32
8 0.34
9 0.35
10 0.34
11 0.34
12 0.31
13 0.3
14 0.31
15 0.31
16 0.28
17 0.24
18 0.21
19 0.17
20 0.12
21 0.12
22 0.1
23 0.09
24 0.11
25 0.11
26 0.1
27 0.11
28 0.11
29 0.1
30 0.09
31 0.11
32 0.12
33 0.13
34 0.14
35 0.16
36 0.16
37 0.19
38 0.19
39 0.23
40 0.28
41 0.29
42 0.35
43 0.36
44 0.39
45 0.38
46 0.41
47 0.36
48 0.27
49 0.29
50 0.28
51 0.32
52 0.3
53 0.32
54 0.33
55 0.4
56 0.41
57 0.37
58 0.32
59 0.26
60 0.35
61 0.35
62 0.38
63 0.33
64 0.33
65 0.33
66 0.33
67 0.37
68 0.28
69 0.24
70 0.19
71 0.17
72 0.16
73 0.15
74 0.15
75 0.08
76 0.09
77 0.09
78 0.08
79 0.12
80 0.13
81 0.13
82 0.19
83 0.22
84 0.24
85 0.28
86 0.31
87 0.31
88 0.31
89 0.31
90 0.27
91 0.27
92 0.25
93 0.22
94 0.2
95 0.18
96 0.17
97 0.22
98 0.26
99 0.27
100 0.28
101 0.28
102 0.28
103 0.3
104 0.28
105 0.25
106 0.19
107 0.17
108 0.17
109 0.17
110 0.15
111 0.13
112 0.13
113 0.14
114 0.15
115 0.14
116 0.12
117 0.11
118 0.1
119 0.1
120 0.09
121 0.08
122 0.06
123 0.06
124 0.06
125 0.06
126 0.07
127 0.06
128 0.05
129 0.04
130 0.05
131 0.05
132 0.05
133 0.05
134 0.04
135 0.05
136 0.05
137 0.08
138 0.07
139 0.07
140 0.07
141 0.07
142 0.08
143 0.06
144 0.06
145 0.04
146 0.04
147 0.05
148 0.05
149 0.05
150 0.06
151 0.06
152 0.07
153 0.07
154 0.07
155 0.08
156 0.17
157 0.23
158 0.23
159 0.25
160 0.25
161 0.3
162 0.32
163 0.31
164 0.25
165 0.25
166 0.28
167 0.32
168 0.35
169 0.31
170 0.34
171 0.34
172 0.34
173 0.36
174 0.39
175 0.4
176 0.36
177 0.37
178 0.35
179 0.37
180 0.37
181 0.38
182 0.36
183 0.3
184 0.36
185 0.38
186 0.36
187 0.38
188 0.35
189 0.28
190 0.25
191 0.26
192 0.19
193 0.17
194 0.15
195 0.12
196 0.1
197 0.09
198 0.09
199 0.11
200 0.09
201 0.09
202 0.09
203 0.09
204 0.09
205 0.1
206 0.1
207 0.07
208 0.07
209 0.08
210 0.08
211 0.08
212 0.08
213 0.08
214 0.08
215 0.08
216 0.08
217 0.09
218 0.12
219 0.12
220 0.12
221 0.12
222 0.11
223 0.11
224 0.13
225 0.11
226 0.09
227 0.09
228 0.09
229 0.09
230 0.1
231 0.11
232 0.09
233 0.09
234 0.08
235 0.08
236 0.08
237 0.08
238 0.09
239 0.09
240 0.08
241 0.08
242 0.09
243 0.09
244 0.09
245 0.09
246 0.08
247 0.07
248 0.07
249 0.08
250 0.08
251 0.07
252 0.07
253 0.09
254 0.08
255 0.08
256 0.09
257 0.08
258 0.08
259 0.08
260 0.08
261 0.08
262 0.08
263 0.1
264 0.11
265 0.13
266 0.15
267 0.16
268 0.2
269 0.19
270 0.21
271 0.23
272 0.23
273 0.24
274 0.28
275 0.27
276 0.23
277 0.23
278 0.21
279 0.17
280 0.16
281 0.13
282 0.08
283 0.09
284 0.09
285 0.09
286 0.09
287 0.11
288 0.18
289 0.21
290 0.25
291 0.32
292 0.39
293 0.41
294 0.48
295 0.53
296 0.51
297 0.56
298 0.58
299 0.55
300 0.48
301 0.46
302 0.4
303 0.34
304 0.3
305 0.25
306 0.19
307 0.14
308 0.14
309 0.14
310 0.14
311 0.21
312 0.26
313 0.33
314 0.4
315 0.49
316 0.57
317 0.63
318 0.7
319 0.72
320 0.75
321 0.77
322 0.8
323 0.77
324 0.74
325 0.69
326 0.69
327 0.63
328 0.53
329 0.49
330 0.44
331 0.41
332 0.39
333 0.37
334 0.3
335 0.33
336 0.33
337 0.26
338 0.23
339 0.22
340 0.21
341 0.25
342 0.27
343 0.23
344 0.26
345 0.28
346 0.26
347 0.27
348 0.25
349 0.22
350 0.24
351 0.23
352 0.23
353 0.22
354 0.24
355 0.29
356 0.33
357 0.38
358 0.36
359 0.4
360 0.44
361 0.5
362 0.56
363 0.52
364 0.49
365 0.43
366 0.44
367 0.4
368 0.35
369 0.34
370 0.26
371 0.25
372 0.29
373 0.3
374 0.31
375 0.35
376 0.4