Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U8P5

Protein Details
Accession A0A397U8P5    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-35PEKEKEKEETEGKKRKKRKKEEVANNLSTCBasic
NLS Segment(s)
PositionSequence
3-25KKPPEKEKEKEETEGKKRKKRKK
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MEKKPPEKEKEKEETEGKKRKKRKKEEVANNLSTCHFRRRLVFVCGHGYHLICYNAKCIHCEEFYKKGIFKNVKKFLERIEKGANTLTNEDLDDDDEDDVEGMEETIEEVEEALDITSKLLVEIEQIKYW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.75
4 0.75
5 0.76
6 0.81
7 0.85
8 0.87
9 0.89
10 0.89
11 0.9
12 0.92
13 0.93
14 0.94
15 0.93
16 0.88
17 0.77
18 0.67
19 0.57
20 0.49
21 0.41
22 0.37
23 0.31
24 0.27
25 0.3
26 0.36
27 0.39
28 0.41
29 0.42
30 0.37
31 0.4
32 0.38
33 0.37
34 0.3
35 0.26
36 0.21
37 0.21
38 0.2
39 0.14
40 0.14
41 0.15
42 0.18
43 0.18
44 0.18
45 0.18
46 0.19
47 0.19
48 0.23
49 0.24
50 0.25
51 0.27
52 0.28
53 0.27
54 0.26
55 0.32
56 0.37
57 0.39
58 0.44
59 0.51
60 0.53
61 0.54
62 0.53
63 0.52
64 0.55
65 0.49
66 0.44
67 0.41
68 0.37
69 0.37
70 0.38
71 0.33
72 0.24
73 0.24
74 0.2
75 0.14
76 0.14
77 0.13
78 0.11
79 0.11
80 0.09
81 0.09
82 0.08
83 0.08
84 0.07
85 0.07
86 0.06
87 0.05
88 0.05
89 0.04
90 0.04
91 0.03
92 0.04
93 0.04
94 0.04
95 0.03
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.05
102 0.05
103 0.05
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.1
110 0.15