Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VKV2

Protein Details
Accession A0A397VKV2    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
28-59GSSSFATKKAKKAKKAKKNKDKGKTKEIKETVHydrophilic
187-207ENNSRKVPNLSNPKNKQPPSFHydrophilic
NLS Segment(s)
PositionSequence
35-54KKAKKAKKAKKNKDKGKTKE
Subcellular Location(s) nucl 18, mito_nucl 13.5, mito 7
Family & Domain DBs
Amino Acid Sequences MSYYKDTKKVGKMFTRLTTGGSNPVMAGSSSFATKKAKKAKKAKKNKDKGKTKEIKETVGHAPLLIELSDRVSPASDVSIPPITASYEYTSGSESQIILAEIKKLLDNQGKLMHKFDRLMPRFEEMEERIDSRLRAVDDKLFATLDVSELQSFVESTVKGASNALIKKTVYPTQQELKEVVKDYLEENNSRKVPNLSNPKNKQPPSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.64
3 0.55
4 0.51
5 0.45
6 0.38
7 0.37
8 0.31
9 0.26
10 0.2
11 0.2
12 0.17
13 0.13
14 0.13
15 0.08
16 0.09
17 0.1
18 0.11
19 0.13
20 0.2
21 0.24
22 0.32
23 0.41
24 0.49
25 0.57
26 0.68
27 0.77
28 0.81
29 0.88
30 0.91
31 0.91
32 0.94
33 0.94
34 0.94
35 0.94
36 0.9
37 0.9
38 0.88
39 0.82
40 0.81
41 0.74
42 0.68
43 0.59
44 0.56
45 0.48
46 0.42
47 0.37
48 0.26
49 0.23
50 0.18
51 0.17
52 0.12
53 0.08
54 0.05
55 0.07
56 0.08
57 0.08
58 0.07
59 0.07
60 0.07
61 0.07
62 0.09
63 0.08
64 0.07
65 0.1
66 0.11
67 0.11
68 0.1
69 0.1
70 0.1
71 0.09
72 0.1
73 0.09
74 0.09
75 0.09
76 0.1
77 0.1
78 0.1
79 0.1
80 0.09
81 0.08
82 0.07
83 0.07
84 0.07
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.1
93 0.14
94 0.14
95 0.15
96 0.22
97 0.24
98 0.25
99 0.27
100 0.25
101 0.23
102 0.23
103 0.27
104 0.3
105 0.3
106 0.32
107 0.31
108 0.32
109 0.31
110 0.3
111 0.29
112 0.2
113 0.21
114 0.19
115 0.19
116 0.17
117 0.17
118 0.17
119 0.14
120 0.16
121 0.13
122 0.14
123 0.15
124 0.17
125 0.18
126 0.19
127 0.18
128 0.15
129 0.14
130 0.13
131 0.11
132 0.09
133 0.08
134 0.08
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.07
141 0.08
142 0.07
143 0.08
144 0.11
145 0.11
146 0.11
147 0.12
148 0.13
149 0.17
150 0.19
151 0.2
152 0.2
153 0.2
154 0.23
155 0.27
156 0.31
157 0.29
158 0.32
159 0.36
160 0.41
161 0.44
162 0.43
163 0.4
164 0.38
165 0.39
166 0.37
167 0.32
168 0.24
169 0.22
170 0.22
171 0.27
172 0.27
173 0.27
174 0.28
175 0.35
176 0.37
177 0.36
178 0.38
179 0.35
180 0.38
181 0.43
182 0.52
183 0.54
184 0.62
185 0.69
186 0.76
187 0.82