Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VFV9

Protein Details
Accession A0A397VFV9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
64-83VKSFYDQNIKNKKKNKLKNGHydrophilic
NLS Segment(s)
PositionSequence
74-82NKKKNKLKN
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MINDLNVFNDQMTAYNDKDEQLYQQLQLMFAMFIILMIGAELLHFISEIYSNKAKRIEKGVEDVKSFYDQNIKNKKKNKLKNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.18
4 0.17
5 0.19
6 0.17
7 0.16
8 0.18
9 0.18
10 0.16
11 0.19
12 0.19
13 0.18
14 0.17
15 0.15
16 0.1
17 0.08
18 0.08
19 0.04
20 0.04
21 0.03
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.03
34 0.05
35 0.06
36 0.1
37 0.15
38 0.16
39 0.18
40 0.25
41 0.26
42 0.27
43 0.34
44 0.34
45 0.33
46 0.4
47 0.44
48 0.41
49 0.41
50 0.39
51 0.33
52 0.32
53 0.29
54 0.23
55 0.26
56 0.27
57 0.36
58 0.46
59 0.53
60 0.58
61 0.66
62 0.76
63 0.78