Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UM32

Protein Details
Accession A0A397UM32    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MGRLRRSRTHKGIRDQYRKQRTRNYTKDLDHydrophilic
NLS Segment(s)
PositionSequence
83-86HKKR
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRLRRSRTHKGIRDQYRKQRTRNYTKDLDQIHKELKELDEQMVSNQELDPDLPGFGKYPCVACSRYFINQKALDEHNRGKLHKKRIKLLKEVPYTQSEAEAAVGYSTENSRIKAMKDISY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.89
4 0.89
5 0.87
6 0.84
7 0.84
8 0.84
9 0.84
10 0.83
11 0.8
12 0.77
13 0.73
14 0.73
15 0.68
16 0.64
17 0.56
18 0.51
19 0.48
20 0.41
21 0.37
22 0.32
23 0.28
24 0.26
25 0.23
26 0.2
27 0.17
28 0.16
29 0.16
30 0.17
31 0.16
32 0.12
33 0.11
34 0.1
35 0.08
36 0.08
37 0.08
38 0.06
39 0.06
40 0.06
41 0.06
42 0.07
43 0.06
44 0.08
45 0.07
46 0.08
47 0.1
48 0.12
49 0.14
50 0.13
51 0.16
52 0.18
53 0.23
54 0.28
55 0.28
56 0.32
57 0.32
58 0.33
59 0.34
60 0.34
61 0.33
62 0.33
63 0.34
64 0.36
65 0.36
66 0.37
67 0.42
68 0.46
69 0.53
70 0.54
71 0.56
72 0.58
73 0.65
74 0.71
75 0.71
76 0.72
77 0.71
78 0.73
79 0.71
80 0.65
81 0.58
82 0.53
83 0.44
84 0.36
85 0.26
86 0.19
87 0.16
88 0.13
89 0.1
90 0.07
91 0.07
92 0.06
93 0.07
94 0.07
95 0.12
96 0.14
97 0.15
98 0.19
99 0.22
100 0.24
101 0.3