Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UBA6

Protein Details
Accession A0A397UBA6    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-73WEKSNRISRRDKVENKRKKNPKDPRKDRPKKELLSEKEKKKLRQEIKEKEHAEBasic
NLS Segment(s)
PositionSequence
26-67RISRRDKVENKRKKNPKDPRKDRPKKELLSEKEKKKLRQEIK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MVWNIFYEEIWRIRCEDMINWEKSNRISRRDKVENKRKKNPKDPRKDRPKKELLSEKEKKKLRQEIKEKEHAEECRREKLLEEAIEKLIAKGEKPFWYGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.22
4 0.27
5 0.32
6 0.35
7 0.34
8 0.34
9 0.35
10 0.36
11 0.43
12 0.39
13 0.39
14 0.44
15 0.48
16 0.57
17 0.65
18 0.71
19 0.72
20 0.79
21 0.81
22 0.82
23 0.87
24 0.88
25 0.87
26 0.88
27 0.88
28 0.87
29 0.88
30 0.89
31 0.89
32 0.91
33 0.92
34 0.88
35 0.87
36 0.85
37 0.76
38 0.75
39 0.73
40 0.68
41 0.68
42 0.69
43 0.64
44 0.64
45 0.66
46 0.63
47 0.63
48 0.67
49 0.65
50 0.68
51 0.73
52 0.75
53 0.77
54 0.82
55 0.74
56 0.67
57 0.64
58 0.6
59 0.55
60 0.53
61 0.49
62 0.47
63 0.47
64 0.44
65 0.4
66 0.4
67 0.41
68 0.37
69 0.36
70 0.31
71 0.3
72 0.32
73 0.3
74 0.25
75 0.22
76 0.18
77 0.16
78 0.19
79 0.24
80 0.26