Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TPW6

Protein Details
Accession A0A397TPW6    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
151-170YKNWRKYTFKAKIADKKVTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046700  DUF6570  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20209  DUF6570  
Amino Acid Sequences MESCNRCNKEKLMPRRFSAENNVDPDEKFSAELPQLNQDKEMFIAQILPMLTVYKLQGGQLGYRGNVIHFAQDIQKFITKLTRNPSTIDTLNIRKPGQDFISFQEFKMIEYFNFGQIISKAIILFIPLLNYFKSPFTSDLLFNITLFIIDYKNWRKYTFKAKIADKKVTFFVND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.67
4 0.61
5 0.6
6 0.57
7 0.52
8 0.51
9 0.51
10 0.45
11 0.43
12 0.42
13 0.34
14 0.26
15 0.21
16 0.16
17 0.17
18 0.18
19 0.21
20 0.19
21 0.25
22 0.28
23 0.28
24 0.29
25 0.25
26 0.23
27 0.21
28 0.21
29 0.12
30 0.09
31 0.1
32 0.08
33 0.1
34 0.09
35 0.08
36 0.08
37 0.08
38 0.08
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.11
45 0.11
46 0.11
47 0.14
48 0.15
49 0.13
50 0.14
51 0.14
52 0.11
53 0.13
54 0.12
55 0.1
56 0.09
57 0.1
58 0.13
59 0.14
60 0.15
61 0.13
62 0.15
63 0.15
64 0.15
65 0.21
66 0.19
67 0.22
68 0.27
69 0.32
70 0.3
71 0.32
72 0.33
73 0.3
74 0.29
75 0.27
76 0.24
77 0.22
78 0.24
79 0.25
80 0.24
81 0.21
82 0.21
83 0.22
84 0.21
85 0.2
86 0.19
87 0.19
88 0.28
89 0.27
90 0.26
91 0.29
92 0.26
93 0.24
94 0.25
95 0.22
96 0.13
97 0.18
98 0.19
99 0.14
100 0.14
101 0.14
102 0.13
103 0.12
104 0.15
105 0.1
106 0.1
107 0.08
108 0.08
109 0.08
110 0.07
111 0.08
112 0.06
113 0.07
114 0.07
115 0.09
116 0.09
117 0.1
118 0.11
119 0.11
120 0.13
121 0.14
122 0.16
123 0.17
124 0.19
125 0.19
126 0.2
127 0.23
128 0.21
129 0.18
130 0.17
131 0.14
132 0.12
133 0.11
134 0.11
135 0.07
136 0.08
137 0.16
138 0.23
139 0.31
140 0.33
141 0.36
142 0.39
143 0.45
144 0.56
145 0.57
146 0.57
147 0.58
148 0.66
149 0.74
150 0.77
151 0.81
152 0.72
153 0.66
154 0.62